DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Acbp1 and acbp-6

Sequence 1:NP_001285744.1 Gene:Acbp1 FlyBaseID:FBgn0031992 Length:90 Species:Drosophila melanogaster
Sequence 2:NP_496552.1 Gene:acbp-6 WormBaseID:WBGene00012457 Length:115 Species:Caenorhabditis elegans

Alignment Length:98 Identity:34/99 (34%)
Similarity:54/99 (55%) Gaps:13/99 (13%)


  Fly     1 MSELQE------FNQAAEDVKNLNTTPGDNDLLELYSLYKQATVGDC-NTD----KPGFLDFKGK 54
            :|||::      |..|||:::.|.:.|.|.:.|:||:|||||..||. |.|    ..|  |..|:
 Worm     3 ISELEKKWTGLTFEIAAEEMRRLKSEPTDRERLKLYALYKQALHGDIPNEDVYPVPAG--DEVGR 65

  Fly    55 AKWEAWNNRKGMSNTDAQAAYITKVKALIAAVG 87
            .|:.||.::||.::...:|.|:...:.:|...|
 Worm    66 KKYAAWKSQKGANSEKCRADYVAIAEEMIKKYG 98

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Acbp1NP_001285744.1 ACBP 5..87 CDD:238248 30/93 (32%)
acbp-6NP_496552.1 ACBP 15..95 CDD:279259 30/82 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG4281
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000643
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR23310
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.000

Return to query results.
Submit another query.