DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Acbp1 and acbp-5

Sequence 1:NP_001285744.1 Gene:Acbp1 FlyBaseID:FBgn0031992 Length:90 Species:Drosophila melanogaster
Sequence 2:NP_499817.2 Gene:acbp-5 WormBaseID:WBGene00011731 Length:274 Species:Caenorhabditis elegans

Alignment Length:71 Identity:20/72 (28%)
Similarity:33/72 (46%) Gaps:1/72 (1%)


  Fly     6 EFNQAAEDVKNLNTTPGDNDLLELYSLYKQATVGDCNTDK-PGFLDFKGKAKWEAWNNRKGMSNT 69
            :|:.|...:....|......:|:.|.|||||..|..::.| |.:.:...:.|:.:|.....||.:
 Worm    31 KFDAATTRLPGFLTKIDQKTILKFYGLYKQAVEGPADSKKGPYWFETVARKKFNSWLANSQMSRS 95

  Fly    70 DAQAAY 75
            .|..||
 Worm    96 RAMEAY 101

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Acbp1NP_001285744.1 ACBP 5..87 CDD:238248 20/72 (28%)
acbp-5NP_499817.2 ACBP 29..108 CDD:279259 20/72 (28%)
Ank_2 160..253 CDD:289560
ANK 161..272 CDD:238125
ANK repeat 188..220 CDD:293786
ANK repeat 222..253 CDD:293786
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG4281
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.