DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Acbp1 and ech-4

Sequence 1:NP_001285744.1 Gene:Acbp1 FlyBaseID:FBgn0031992 Length:90 Species:Drosophila melanogaster
Sequence 2:NP_496330.1 Gene:ech-4 WormBaseID:WBGene00001153 Length:385 Species:Caenorhabditis elegans

Alignment Length:80 Identity:36/81 (44%)
Similarity:53/81 (65%) Gaps:2/81 (2%)


  Fly     6 EFNQAAEDVKNLNTTPGDNDL-LELYSLYKQATVGDCNTDKPGFLDFKGKAKWEAWNNRKGMSNT 69
            :|.:|.:::|.|...| |||: |:||.|:||||.||....:||.:||.|:||::|||..||.:..
 Worm    28 DFEKAQKNLKTLKEEP-DNDVKLQLYGLFKQATAGDVQGKRPGMMDFVGRAKYDAWNTLKGQTQD 91

  Fly    70 DAQAAYITKVKALIA 84
            :|:|.|...|..||:
 Worm    92 EARANYAKLVGGLIS 106

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Acbp1NP_001285744.1 ACBP 5..87 CDD:238248 36/81 (44%)
ech-4NP_496330.1 ACBP 25..109 CDD:238248 36/81 (44%)
crotonase-like 129..326 CDD:119339
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG4281
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 LDO PTHR23310
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.