DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Acbp1 and acbp-1

Sequence 1:NP_001285744.1 Gene:Acbp1 FlyBaseID:FBgn0031992 Length:90 Species:Drosophila melanogaster
Sequence 2:NP_491412.1 Gene:acbp-1 WormBaseID:WBGene00016655 Length:86 Species:Caenorhabditis elegans

Alignment Length:81 Identity:45/82 (55%)
Similarity:59/82 (72%) Gaps:0/82 (0%)


  Fly     7 FNQAAEDVKNLNTTPGDNDLLELYSLYKQATVGDCNTDKPGFLDFKGKAKWEAWNNRKGMSNTDA 71
            |:.||..||.|.|:|.:::||:||:|:||.||||..|||||..|.||||||.||:.:||::..||
 Worm     5 FDDAAATVKTLKTSPSNDELLKLYALFKQGTVGDNTTDKPGMFDLKGKAKWSAWDEKKGLAKDDA 69

  Fly    72 QAAYITKVKALIAAVG 87
            |.||:..|:.|||..|
 Worm    70 QKAYVALVEELIAKYG 85

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Acbp1NP_001285744.1 ACBP 5..87 CDD:238248 44/80 (55%)
acbp-1NP_491412.1 ACBP 1..85 CDD:238248 44/80 (55%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1588000at2759
OrthoFinder 1 1.000 FOG0000643
OrthoInspector 1 1.000 T374923
orthoMCL 1 0.900 OOG5_127366
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R12
TreeFam 00.000 Not matched by this tool.
65.940

Return to query results.
Submit another query.