DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Acbp1 and DBI

DIOPT Version :9

Sequence 1:NP_001285744.1 Gene:Acbp1 / 34111 FlyBaseID:FBgn0031992 Length:90 Species:Drosophila melanogaster
Sequence 2:NP_001171488.1 Gene:DBI / 1622 HGNCID:2690 Length:148 Species:Homo sapiens


Alignment Length:83 Identity:47/83 - (56%)
Similarity:59/83 - (71%) Gaps:0/83 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 EFNQAAEDVKNLNTTPGDNDLLELYSLYKQATVGDCNTDKPGFLDFKGKAKWEAWNNRKGMSNTD 70
            ||.:|||:|::|.|.|.|.::|.:|..||||||||.||::||.|||.|||||:|||..||.|..|
Human    66 EFEKAAEEVRHLKTKPSDEEMLFIYGHYKQATVGDINTERPGMLDFTGKAKWDAWNELKGTSKED 130

  Fly    71 AQAAYITKVKALIAAVGL 88
            |..|||.||:.|....|:
Human   131 AMKAYINKVEELKKKYGI 148

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Acbp1NP_001285744.1 ACBP 5..87 CDD:238248 46/80 (58%)
DBINP_001171488.1 ACBP 74..147 CDD:238248 41/72 (57%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 102 1.000 Domainoid score I6842
eggNOG 1 0.900 - - E1_COG4281
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 104 1.000 Inparanoid score I4956
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG63566
OrthoDB 1 1.010 - - D1588000at2759
OrthoFinder 1 1.000 - - FOG0001211
OrthoInspector 1 1.000 - - otm40381
orthoMCL 1 0.900 - - OOG6_101568
Panther 1 1.100 - - LDO PTHR23310
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R12
SonicParanoid 1 1.000 - - X1384
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
1413.910

Return to query results.
Submit another query.