DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Acbp1 and DBI

Sequence 1:NP_001285744.1 Gene:Acbp1 FlyBaseID:FBgn0031992 Length:90 Species:Drosophila melanogaster
Sequence 2:NP_001171488.1 Gene:DBI HGNCID:2690 Length:148 Species:Homo sapiens

Alignment Length:83 Identity:47/84 (56%)
Similarity:59/84 (70%) Gaps:0/84 (0%)


  Fly     6 EFNQAAEDVKNLNTTPGDNDLLELYSLYKQATVGDCNTDKPGFLDFKGKAKWEAWNNRKGMSNTD 70
            ||.:|||:|::|.|.|.|.::|.:|..||||||||.||::||.|||.|||||:|||..||.|..|
Human    66 EFEKAAEEVRHLKTKPSDEEMLFIYGHYKQATVGDINTERPGMLDFTGKAKWDAWNELKGTSKED 130

  Fly    71 AQAAYITKVKALIAAVGL 88
            |..|||.||:.|....|:
Human   131 AMKAYINKVEELKKKYGI 148

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Acbp1NP_001285744.1 ACBP 5..87 CDD:238248 46/81 (57%)
DBINP_001171488.1 ACBP 74..147 CDD:238248 41/73 (56%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG4281
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 104 1.000 Inparanoid score I4873
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D1588000at2759
OrthoFinder 1 1.000 FOG0000643
OrthoInspector 1 1.000 T609893
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 LDO PTHR23310
Phylome 1 0.910 0.600 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R12
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
1010.010

Return to query results.
Submit another query.