DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Acbp1 and Dbil5

Sequence 1:NP_001285744.1 Gene:Acbp1 FlyBaseID:FBgn0031992 Length:90 Species:Drosophila melanogaster
Sequence 2:NP_067269.1 Gene:Dbil5 MGIID:108039 Length:87 Species:Mus musculus

Alignment Length:82 Identity:39/83 (47%)
Similarity:47/83 (57%) Gaps:1/83 (1%)


  Fly     1 MSELQEFNQAAEDVKNLNTTPGDNDLLELYSLYKQATVGDCNTDKPGFLDFKGKAKWEAWNNRKG 65
            ||:: ||..|...:|.|.....|.:.|.:||.|||||.||||...|...|.:.|||:|||...||
Mouse     1 MSQV-EFEMACASLKQLKGPVSDQEKLLVYSFYKQATQGDCNIPVPPATDVRAKAKYEAWMVNKG 64

  Fly    66 MSNTDAQAAYITKVKAL 82
            ||..||...||.||:.|
Mouse    65 MSKMDAMRIYIAKVEEL 81

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Acbp1NP_001285744.1 ACBP 5..87 CDD:238248 37/79 (47%)
Dbil5NP_067269.1 ACBP 2..86 CDD:238248 38/82 (46%)
Acyl-CoA binding. {ECO:0000250} 29..33 3/4 (75%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG4281
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1588000at2759
OrthoFinder 1 1.000 FOG0000643
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_127366
Panther 1 1.100 O PTHR23310
Phylome 1 0.910 0.600 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.820

Return to query results.
Submit another query.