DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Acbp1 and Dbi

Sequence 1:NP_001285744.1 Gene:Acbp1 FlyBaseID:FBgn0031992 Length:90 Species:Drosophila melanogaster
Sequence 2:NP_001033088.1 Gene:Dbi MGIID:94865 Length:135 Species:Mus musculus

Alignment Length:83 Identity:45/84 (54%)
Similarity:57/84 (68%) Gaps:0/84 (0%)


  Fly     6 EFNQAAEDVKNLNTTPGDNDLLELYSLYKQATVGDCNTDKPGFLDFKGKAKWEAWNNRKGMSNTD 70
            ||::|||:||.|.|.|.|.::|.:||.:|||||||.|||:||.||.||||||::||..||.|...
Mouse    53 EFDKAAEEVKRLKTQPTDEEMLFIYSHFKQATVGDVNTDRPGLLDLKGKAKWDSWNKLKGTSKES 117

  Fly    71 AQAAYITKVKALIAAVGL 88
            |...|:.||..|....|:
Mouse   118 AMKTYVEKVDELKKKYGI 135

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Acbp1NP_001285744.1 ACBP 5..87 CDD:238248 44/81 (54%)
DbiNP_001033088.1 ACBP 52..134 CDD:238248 44/81 (54%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG4281
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 98 1.000 Inparanoid score I4971
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000643
OrthoInspector 1 1.000 T616706
orthoMCL 1 0.900 OOG5_127366
Panther 1 1.100 LDO PTHR23310
Phylome 1 0.910 0.600 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R12
TreeFam 00.000 Not matched by this tool.
109.900

Return to query results.
Submit another query.