DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Rbsn-5 and PEP7

Sequence 1:NP_609186.1 Gene:Rbsn-5 FlyBaseID:FBgn0261064 Length:505 Species:Drosophila melanogaster
Sequence 2:NP_010610.3 Gene:PEP7 SGDID:S000002731 Length:515 Species:Saccharomyces cerevisiae

Alignment Length:571 Identity:126/572 (22%)
Similarity:208/572 (36%) Gaps:166/572 (29%)


  Fly    20 LEGFLCPICRADLKSIDVLTDHFARQHA--EEEDALKSFKDIFTKAKKKILNPFEDEKGASVSSP 82
            ||...||||.....::..|..|...:|.  :.||:|.|........|:|        |..||.|.
Yeast     3 LENVSCPICLRKFDNLQALNAHLDVEHGFNDNEDSLGSNDSRLVNGKQK--------KARSVDSS 59

  Fly    83 A--------------GSSSSAAGKNPNGNGDRNGPSNARS--------------RLNV-FNYMAR 118
            |              .|.....|:..|.|   .|..|.|.              :||: ..|..|
Yeast    60 AQKLKRSHWEKFKKGKSCCHTCGRTLNNN---IGAINCRKCGKLYCRRHLPNMIKLNLSAQYDPR 121

  Fly   119 QQPGAECSHF-------------------EYFQSIRNPRLE----RYASETNKLI------IRLH 154
            ......|.|.                   |:|: :||.:.|    |.....|:.:      |.|:
Yeast   122 NGKWYNCCHDCFVTKPGYNDYGEVIDLTPEFFK-VRNIKREDKNLRLLQLENRFVRLVDGLITLY 185

  Fly   155 R-----LLKDLPADSVQRRQHEQQTVAWLDGSSVKLCPSCAKSFHIARRQHHCRLCGGIMCND-- 212
            .     ::.:|..:| :..:.|:....|.|..||..|..|::.|.:..|:|||||||.::|:|  
Yeast   186 NTYSRSIIHNLKMNS-EMSKLERTVTPWRDDRSVLFCNICSEPFGLLLRKHHCRLCGMVVCDDAN 249

  Fly   213 --CSKFLPLEDAMQLASLSTTRSEPLQQLHQHEN------AIRLCEHCLWLL----DTRKDMHES 265
              ||..:.:...|..||     ..|.:...|.::      :||||.||:.:|    ...||:.  
Yeast   250 RNCSNEISIGYLMSAAS-----DLPFEYNIQKDDLLHIPISIRLCSHCIDMLFIGRKFNKDVR-- 307

  Fly   266 RTCRPL--LVQVYEQIRQLQKEVTPDLDMYLKIINSL------NEGDTI--FTLADAGALRGKIG 320
               .||  :...|:.::.:.|.:...|.::...:|||      :..:|:  ..|.|...||.|:.
Yeast   308 ---MPLSGIFAKYDSMQNISKVIDSLLPIFEDSLNSLKVETAKDSENTLDPKNLNDLARLRHKLL 369

  Fly   321 QVAEAMDMRSKRILAIFCEPGSR-EEALKKAIRLGCIQAIKERMLSLPPLP----EESHIRQMQE 380
            ......:..::::|::  ||.|. |..|:.:|::.....|.|::|.|..||    .|.| :..::
Yeast   370 NSFNLYNTLTRQLLSV--EPQSHLERQLQNSIKIASAAYINEKILPLKSLPAILNPEGH-KTNED 431

  Fly   381 RRRMETE----QRILTEQRMAMEAYE-RNNMAANQSNVGVPGPESGSFAQGSDLQSLNNWSAPQA 440
            .::.|.|    .:::.|.....|..| |..:..                                
Yeast   432 GQKAEPEVKKLSQLMIENLTIKEVKELREELMV-------------------------------- 464

  Fly   441 ASKSSLDDPLIEQINIIKGYIKQARQDMNFEVVETLELNLRELQREVYERQ 491
                     |.||..:|:..|:..::....|.:.||..||.||...::..|
Yeast   465 ---------LKEQSYLIESTIQDYKKQRRLEEIVTLNKNLEELHSRIHTVQ 506

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Rbsn-5NP_609186.1 FYVE_RBNS5 174..259 CDD:277256 31/99 (31%)
Rbsn 449..487 CDD:288341 12/38 (32%)
PEP7NP_010610.3 FYVE1_Vac1p_like 65..141 CDD:277300 13/79 (16%)
FYVE2_Vac1p_like 211..293 CDD:277276 30/87 (34%)
Rbsn 464..503 CDD:288341 12/80 (15%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG1842
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0003822
OrthoInspector 1 1.000 T1136496
orthoMCL 1 0.900 OOG5_130880
Panther 1 1.100 LDO PTHR13510
Phylome 1 0.910 0.889 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R8149
TreeFam 00.000 Not matched by this tool.
87.840

Return to query results.
Submit another query.