DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Rbsn-5 and RBSN

Sequence 1:NP_609186.1 Gene:Rbsn-5 FlyBaseID:FBgn0261064 Length:505 Species:Drosophila melanogaster
Sequence 2:NP_001289307.1 Gene:RBSN HGNCID:20759 Length:784 Species:Homo sapiens

Alignment Length:522 Identity:158/523 (30%)
Similarity:253/523 (48%) Gaps:75/523 (14%)


  Fly    17 GEILEGFLCPICRADLKSIDVLTDHFARQHA-EEEDALKSFKDIFTKAKK---KILNPFEDEKGA 77
            ||:.||||||:|..||:|...|..|:..:|: |:.|.....|.:..||||   ::|....|::..
Human     8 GEVREGFLCPLCLKDLQSFYQLHSHYEEEHSGEDRDVKGQIKSLVQKAKKAKDRLLKREGDDRAE 72

  Fly    78 SVSSPAGSSSSAAGKNPNGNGDRNGPSNARSRLNVFNYM-ARQQPGAECSHFEYFQSIRNPRLER 141
            | .:....|.|..|.:|                    || ..|:.||..||...|:..|..|::.
Human    73 S-GTQGYESFSYGGVDP--------------------YMWEPQELGAVRSHLSDFKKHRAARIDH 116

  Fly   142 YASETNKLIIRLHRL--LKDLPADSVQRRQHEQQTVAWLDGSSVKLCPSCAKSFHIARRQHHCRL 204
            |..|.|||||||.:|  ......:|.:.|..|:..|.|::...|..||.|...|.|..|:|||||
Human   117 YVVEVNKLIIRLEKLTAFDRTNTESAKIRAIEKSVVPWVNDQDVPFCPDCGNKFSIRNRRHHCRL 181

  Fly   205 CGGIMCNDCSKFLPLEDAMQLASLS----TTRSEPLQ---QLH-------------------QHE 243
            ||.|||..|.:.:.|..|.:|.|.|    :|.:.|.|   .:|                   :.:
Human   182 CGSIMCKKCMELISLPLANKLTSASKESLSTHTSPSQSPNSVHGSRRGSISSMSSVSSVLDEKDD 246

  Fly   244 NAIRLCEHCLWLLDTRKDMHESRTCRPLLVQVYEQIRQLQKEVTPDLDMYLKIINSLNEGDTIFT 308
            :.||.|.||...|..|:...:.:...|.:|::||::|...::|......|:::..|||.|:|.::
Human   247 DRIRCCTHCKDTLLKREQQIDEKEHTPDIVKLYEKLRLCMEKVDQKAPEYIRMAASLNAGETTYS 311

  Fly   309 LADAGALRGKIGQVAEAMDMRSKRILAIFCE----PGSREEALKKAIRLGCIQAIKERMLSLPPL 369
            |..|..||.::.:|.|.:|..||:||.:...    |......|::.||......::|::|.|..|
Human   312 LEHASDLRVEVQKVYELIDALSKKILTLGLNQDPPPHPSNLRLQRMIRYSATLFVQEKLLGLMSL 376

  Fly   370 PEESHIRQMQERRRMETEQRILTEQRMAMEAYER-----NNMAANQSNVGVPGPESGSFAQG-SD 428
            |.:....:::::|:.|.|::...|::.|:|:..|     :.:|:..:|     .|..|..:| :.
Human   377 PTKEQFEELKKKRKEEMERKRAVERQAALESQRRLEERQSGLASRAAN-----GEVASLRRGPAP 436

  Fly   429 LQSLNNW---SAPQAASKSSLDDPLIEQINIIKGYIKQARQDMNFEVVETLELNLRELQREVYER 490
            |:....|   |..|..|:.|  |||::||:.|..:|:||:.....:.|.||:.|||:||.| |::
Human   437 LRKAEGWLPLSGGQGQSEDS--DPLLQQIHNITSFIRQAKAAGRMDEVRTLQENLRQLQDE-YDQ 498

  Fly   491 QR 492
            |:
Human   499 QQ 500

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Rbsn-5NP_609186.1 FYVE_RBNS5 174..259 CDD:277256 35/111 (32%)
Rbsn 449..487 CDD:288341 17/38 (45%)
RBSNNP_001289307.1 Necessary for the correct targeting to endosomes 100..263 54/163 (33%)
FYVE_RBNS5 151..262 CDD:277256 35/111 (32%)
Necessary for interaction with EHD1. {ECO:0000269|PubMed:15020713} 264..784 70/246 (28%)
Necessary for interaction with RAB4A 264..500 70/244 (29%)
Rbsn 461..497 CDD:314399 16/37 (43%)
NPF 548..727 CDD:318744
Necessary for interaction with RAB5A 627..784
Rbsn 741..777 CDD:314399
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C363910197
eggNOG 1 0.900 E1_KOG1842
Hieranoid 1 1.000
Homologene 1 1.000 H41477
Inparanoid 1 1.050 212 1.000 Inparanoid score I3600
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0003822
OrthoInspector 1 1.000 T1074412
orthoMCL 1 0.900 OOG5_130880
Panther 1 1.100 LDO PTHR13510
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R8149
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
1211.780

Return to query results.
Submit another query.