DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Rbsn-5 and Rbsn

Sequence 1:NP_609186.1 Gene:Rbsn-5 FlyBaseID:FBgn0261064 Length:505 Species:Drosophila melanogaster
Sequence 2:NP_001101345.1 Gene:Rbsn RGDID:1305397 Length:783 Species:Rattus norvegicus

Alignment Length:524 Identity:153/525 (29%)
Similarity:247/525 (47%) Gaps:78/525 (15%)


  Fly    16 SGEILEGFLCPICRADLKSIDVLTDHFARQHAEEEDALKSFKDIFTKAKK---KILNPFEDEKGA 77
            :||:.||||||:|..||:|...|..|:..:|:.:.|.....|::..||:|   |:|....|:: .
  Rat     7 AGEVREGFLCPLCLKDLQSFYQLQSHYEEEHSGDRDVKGQIKNLVQKARKAKNKLLKREGDDR-V 70

  Fly    78 SVSSPAGSSSSAAGKNPNGNGDRNGPSNARSRLNVFNYM-ARQQPGAECSHFEYFQSIRNPRLER 141
            ...:....|.|..|.:|                    || ..|:.||..||...|:..|..|::.
  Rat    71 EPGTQGYESFSYGGVDP--------------------YMWEPQELGAMRSHLSDFKKHRAARIDH 115

  Fly   142 YASETNKLIIRLHRL--LKDLPADSVQRRQHEQQTVAWLDGSSVKLCPSCAKSFHIARRQHHCRL 204
            |..|.|||||||.:|  ......::.:.|..|:..|.|::...|..||.|...|.|..|:|||||
  Rat   116 YVIEVNKLIIRLEKLTAFDRTNTETSKIRAIEKSVVPWVNDQDVPFCPDCGNKFSIRNRRHHCRL 180

  Fly   205 CGGIMCNDCSKFLPLEDAMQLASLS----TTRSEPLQ---QLH-------------------QHE 243
            ||.|||..|.:.:.|..|.:|.|.|    :|.:.|.|   .:|                   :.:
  Rat   181 CGSIMCKKCMELIGLPLANKLTSASKDSLSTHTSPSQSPNSVHGSRRGSISSMSSVSSVLDEKDD 245

  Fly   244 NAIRLCEHCLWLLDTRKDMHESRTCRPLLVQVYEQIRQLQKEVTPDLDMYLKIINSLNEGDTIFT 308
            ..||.|.||...|..|:...:.:...|.:|::||::|...::|......|:::..|||.|:|.::
  Rat   246 ERIRCCTHCKDTLLKREQQMDEKEHTPDIVKLYEKLRLCMEKVDQKAPEYIRMAASLNAGETTYS 310

  Fly   309 LADAGALRGKIGQVAEAMDMRSKRILAIFC----EPGSREEALKKAIRLGCIQAIKERMLSLPPL 369
            |..|..||.::.:|.|.:|..||:||.:..    .|......|::.||......::|::|.|..|
  Rat   311 LEHANDLRVEVQKVYELIDALSKKILTLGLNQDPSPHPNTLRLQRMIRYSATLFVQEKLLGLMSL 375

  Fly   370 PEESHIRQMQERRRMETEQRILTEQRMAMEAYERNNMAANQSNVGVPGPESGSFAQGSDLQSLNN 434
            |.:....:::::|:.:.||:...|::.|:|:  |..:...||.:       .|.....|::||..
  Rat   376 PTKEQFEELKKKRKQDLEQKRTMERQAALES--RRKLEERQSGL-------ASHTANGDMRSLQG 431

  Fly   435 WSAP-----------QAASKSSLDDPLIEQINIIKGYIKQARQDMNFEVVETLELNLRELQREVY 488
            ..||           :...:|...|||::||..|..:|:||:.....:.|.||:.|||:||.| |
  Rat   432 IPAPLRKAEGWLPLSEGQVQSEDPDPLLQQIYNITSFIRQAKAAGRTDEVRTLQENLRQLQDE-Y 495

  Fly   489 ERQR 492
            ::|:
  Rat   496 DQQQ 499

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Rbsn-5NP_609186.1 FYVE_RBNS5 174..259 CDD:277256 35/111 (32%)
Rbsn 449..487 CDD:288341 17/38 (45%)
RbsnNP_001101345.1 FYVE_RBNS5 150..261 CDD:277256 35/111 (32%)
Rbsn 457..496 CDD:288341 18/40 (45%)
NPF 548..726 CDD:293209
Rbsn 740..772 CDD:288341
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C363919144
eggNOG 1 0.900 E1_KOG1842
Hieranoid 1 1.000
Homologene 1 1.000 H41477
Inparanoid 1 1.050 209 1.000 Inparanoid score I3557
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0003822
OrthoInspector 1 1.000 T1088056
orthoMCL 1 0.900 OOG5_130880
Panther 1 1.100 LDO PTHR13510
Phylome 1 0.910 0.667 Consistency score
TreeFam 1 0.960
1211.760

Return to query results.
Submit another query.