DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rbsn-5 and rush

DIOPT Version :10

Sequence 1:NP_609186.1 Gene:Rbsn-5 / 34110 FlyBaseID:FBgn0261064 Length:505 Species:Drosophila melanogaster
Sequence 2:NP_569923.2 Gene:rush / 31105 FlyBaseID:FBgn0025381 Length:316 Species:Drosophila melanogaster


Alignment Length:198 Identity:41/198 - (20%)
Similarity:68/198 - (34%) Gaps:53/198 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   203 TVDPALKYKGITAFLVDFDSGALAGVHRGRPEDKLGIRGTSTCDLMLENVRVPEANVLGTVGSGM 267
            |||        |.||.:...|.:.|::  ....||.:.....|.|              |...||
  Fly    19 TVD--------TLFLDNTQGGVIGGIN--EKLTKLELLSMVKCGL--------------TTLKGM 59

  Fly   268 RI--AMEQLDRARIGIASQAIGIGQAALETAVEYAKQ--RTAFGGTLIDLPAVRTRIAEMGTRLE 328
            .:  |:..||     ::...:| ..|:.:..::.|.:  :....|..:.|..|||  .:|...|.
  Fly    60 PVLPALNYLD-----LSDNELG-DDASFDVLIKCAPEIKKITLSGNRLTLDNVRT--LKMLPNLM 116

  Fly   329 MARLLVRKAAGEID----------RGLRATKACSM------AKWIAGETATYAAHGCQQILG-GM 376
            ...|....:.|.:|          ..|:....|.:      .::.|||.|..:..|.....| |:
  Fly   117 ELDLSNNSSLGLLDDYRVKMFEMIPSLKILDGCDVDGEEVEEEFAAGEGAEDSDEGDSDEDGPGL 181

  Fly   377 GYV 379
            .|:
  Fly   182 SYL 184

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rbsn-5NP_609186.1 FYVE_RBNS5 174..259 CDD:277256 12/55 (22%)
Rbsn 452..490 CDD:463283
rushNP_569923.2 PH_Phafin2-like 7..129 CDD:269927 30/141 (21%)
FYVE_PKHF 148..208 CDD:277257 9/37 (24%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.