DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rbsn-5 and fgd1

DIOPT Version :10

Sequence 1:NP_609186.1 Gene:Rbsn-5 / 34110 FlyBaseID:FBgn0261064 Length:505 Species:Drosophila melanogaster
Sequence 2:XP_004914246.1 Gene:fgd1 / 100489369 XenbaseID:XB-GENE-6453246 Length:913 Species:Xenopus tropicalis


Alignment Length:35 Identity:15/35 - (42%)
Similarity:24/35 - (68%) Gaps:1/35 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly   183 VKLCPSCAKSFH-IARRQHHCRLCGGIMCNDCSKF 216
            |.:|..|.:.|: |.:|:|||:.||.::|..||:|
 Frog   699 VTMCMKCQEPFNSITKRRHHCKACGHVVCGKCSEF 733

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rbsn-5NP_609186.1 FYVE_RBNS5 174..259 CDD:277256 15/35 (43%)
Rbsn 452..490 CDD:463283
fgd1XP_004914246.1 PHA03247 <6..207 CDD:223021
PspC_subgroup_2 <54..>122 CDD:468202
RhoGEF 341..525 CDD:238091
PH1_FGD1 557..664 CDD:275392
FYVE_FGD1_2_4 691..755 CDD:277280 15/35 (43%)
PH2_FGD1-4 780..885 CDD:270056
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.