DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Tg and Epb42

Sequence 1:NP_609174.1 Gene:Tg FlyBaseID:FBgn0031975 Length:776 Species:Drosophila melanogaster
Sequence 2:NP_038541.1 Gene:Epb42 MGIID:95402 Length:691 Species:Mus musculus

Alignment Length:713 Identity:194/714 (27%)
Similarity:324/714 (45%) Gaps:59/714 (8%)


  Fly    54 LGVLKVDLCLEDNHEEHHTSHFYAAAAKEALVVRRGEPFRLKIHFNRDYSPSKDAISFIFTVA-- 116
            |.:...|....:|:|||:|.    |.:.:.|.:|||:.|.:.::|.   :|:...:|.:..||  
Mouse     5 LSIKSCDFHAAENNEEHYTK----AISSQHLTLRRGQSFTITLNFR---APTHTFLSALKKVALI 62

  Fly   117 --DDTKPSPGHGTLNALVPHDGIDYLGDTLEWGAGIESHEGQTLTVLIKPPSTCPVTEWKLDIDT 179
              ...:||..:.| .|:.|   |..|||...|.|.:|..:.|..||.:..|....:..:.|.:..
Mouse    63 AQTGEQPSKINKT-QAIFP---ISSLGDQKGWSAAVEERDAQHWTVSVTTPVDAVIGHYSLLLQV 123

  Fly   180 KLLGDGSRSYPLPLPIYVLFNPWCPDDQVYLEDRDQRKEYVMHDTTLIWRGSYNRLRPSVWKIGQ 244
                .|.:.|||. ...:|||||..||.|:|::..:|.|||::....|:.|:.:.::...|..||
Mouse   124 ----SGKKQYPLG-QFTLLFNPWNRDDAVFLQNEAERTEYVLNQNGFIYLGTADCIQEEPWDFGQ 183

  Fly   245 FERHVLECSLKVLGTVGRIPPAYRGDPVRVARALSALVNSVDDDGVLLGNWSEDFSGGVAPTKWT 309
            ||:.|::.|||:|....::..  ...|..|||.:.||::::....||..:.::....|....|..
Mouse   184 FEKDVMDLSLKLLSMDKQVKD--WNQPAHVARVVGALLHALKKKSVLPISQTQAAQEGALLYKRR 246

  Fly   310 GSVEILQQFYKTQ-KSVKFAQCWNFSGVLTTIARSLGIPSRIITCYSSAHDTQASLTVDVFIDAN 373
            |||.||:|:...| ::|...|.|..:.|..|:.|.||||:|::|.:.||..|..||.||.:.:..
Mouse   247 GSVPILRQWLTGQGRAVYETQAWVSAAVACTVLRCLGIPARVVTTFDSAQGTVGSLLVDEYYNEE 311

  Fly   374 NKKLDAETTDSIWNYHVWNELWMQRPDLGVGEHGTFDGWQVVDATPQEASDNMYRVGPASVAAVK 438
            ..:........||.:....|.||.||||..|    :.|||::.......:..:.......|.|||
Mouse   312 GLQNGEGQRGHIWVFQTSVECWMNRPDLSQG----YGGWQILHPRAPNGAGVLGSCSLVPVRAVK 372

  Fly   439 NGDILRPFDGGFVFAEVNADKLYWR--YNGPSQPLKLLRKDTLAIGHLISTKAVLKWEREDITDT 501
            .|::........:||.|||..:.|:  .:|..:.....|||   :|:.||||.|.....||||..
Mouse   373 EGELQLDPAVPELFAAVNASCVVWKCCEDGKLELTNSNRKD---VGNCISTKVVGSDRCEDITQN 434

  Fly   502 YKHAERSEEERSTMLKALKQSRHAFSRYYL-NDN---------FNDIEFDMELKDDIKI---GQS 553
            ||:...|.:|:..:.|..|:      |..| .||         ::.:....|....|.:   || 
Mouse   435 YKYPAGSLQEKEVLEKVQKE------RLKLGKDNGMCPPSCEPWDPLHMFFEASSSIPLSGDGQ- 492

  Fly   554 FSVVLKVSNKSESRTHMATGQISCDAVLYTGVGAVEVKTLGFELELEPKSSDYVRMEVIFEEYYD 618
            .||.|......|.:.|:..|   ..|:.|.||.|..:.:......|:|.....:...:.|..:..
Mouse   493 LSVTLINPTDEEKKVHLVIG---AQALYYNGVLAAGLWSKKQLFMLKPNQVMRLSTNLSFSCFEQ 554

  Fly   619 KLSSQAAFQISAAAKVKDTDYDYYAQDDFRVRKPDIKFQLGEAAIVAQ-KELDVILRLENPLPIP 682
            .....:..:::|.|:...|....:||::..:.|||:..::.:.|  || :.|.|.:|:.|.|..|
Mouse   555 TPPENSFLRVTAMARYSHTSLSCFAQENMAIGKPDLIIEMPKRA--AQYRPLTVSVRMHNSLEAP 617

  Fly   683 LHKGVFTVEGPG-IEQPLKFKIAEIPVGGTAAATFKYTPPYAGRGTMLAKFTSKELDDVDGYR 744
            :...:.::.|.| |.:..::.:..:..|.:....|::||.:.|...:..:.......::.|||
Mouse   618 MQNCIISIFGRGLIHREKRYGLGSLWPGSSLHTQFQFTPTHLGLQRLTVEVDCDMFQNLTGYR 680

Known Domains:


GeneSequenceDomainRegion External IDIdentity
TgNP_609174.1 Transglut_N 56..179 CDD:279240 34/127 (27%)
TGc 324..419 CDD:214673 32/95 (34%)
Transglut_C 538..644 CDD:279295 22/109 (20%)
Transglut_C 652..750 CDD:279295 22/96 (23%)
Epb42NP_038541.1 Transglut_N 6..123 CDD:279240 34/128 (27%)
Band 3 binding. {ECO:0000250} 31..39 4/8 (50%)
TGc 261..351 CDD:214673 32/94 (34%)
Transglut_C 475..573 CDD:279295 20/102 (20%)
Transglut_C 588..686 CDD:279295 22/96 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_2CD5G
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D153729at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11590
Phylome 1 0.910 0.960 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.