DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Tg and tgm5

Sequence 1:NP_609174.1 Gene:Tg FlyBaseID:FBgn0031975 Length:776 Species:Drosophila melanogaster
Sequence 2:XP_017953286.1 Gene:tgm5 XenbaseID:XB-GENE-986930 Length:692 Species:Xenopus tropicalis

Alignment Length:786 Identity:210/787 (27%)
Similarity:340/787 (43%) Gaps:197/787 (25%)


  Fly    60 DLCLEDNHEEHHTSHFYAAAAKEALVVRRGEPFRLKIHF-NRDYSPSKDAISFIFTVADDTKPSP 123
            |..::.|::.|||..    .....|.:|||:||.:.:|| .|.:.|.:|.:.|:           
 Frog     9 DFQIKRNNKAHHTDE----TGDRRLFIRRGQPFFITVHFKTRGFQPGQDNVIFL----------- 58

  Fly   124 GHGTLNALVPHDGIDYLGDTLEWGAGIESHEGQTLTVLIKPPSTCPVTEWKLDIDTKLLGDGSRS 188
                                                                 ::|         
 Frog    59 -----------------------------------------------------VET--------- 61

  Fly   189 YPLPLPIYVLFNPWCPDDQVYLEDRDQRKEYVMHDTTLIWRGSYNRLRPSVWKIGQFERHVLECS 253
                            ||.|::.:..:|:|||::|...:::|::|.:.|..|..||||..:::.|
 Frog    62 ----------------DDDVFMGNEAERQEYVINDYGFVYQGNHNWIIPCAWNFGQFEDDIVDIS 110

  Fly   254 LKVLG-TVGRIPPAY-----RGDPVRVARALSALVNSVDDDGVLLGNWSEDFSGGVAPTKWTGSV 312
            ||:|. .:..|..::     |.:||.::|.:.|::||.||:|||.||||.|::.||:|:.|.||:
 Frog   111 LKILDKNLNYIQDSFKDLKNRNNPVYISRVICAMINSNDDNGVLQGNWSGDYTNGVSPSAWNGSI 175

  Fly   313 EILQQFYKTQ-KSVKFAQCWNFSGVLTTIARSLGIPSRIITCYSSAHDTQASLTVDVFIDANNKK 376
            .||:|:||:. :.||:.|||.|:.|:.|:.|.||||:|::|.:.|||||..:|.:|.:.|...||
 Frog   176 LILRQWYKSDCQPVKYGQCWVFAAVMCTVMRCLGIPARVVTNFDSAHDTDQNLLIDEYYDTTGKK 240

  Fly   377 LDAETTDSIWNYHVWNELWMQRPDLGVGEHGTFDGWQVVDATPQEASDNMYRVGPASVAAVKNGD 441
            |..||.|||||:|||.|.||.|.||..|    :.||||:|.||||||:.::..|||||.|::.||
 Frog   241 LSKETKDSIWNFHVWCECWMARRDLPPG----YGGWQVLDPTPQEASNGIFVCGPASVKAIREGD 301

  Fly   442 ILRPFDGGFVFAEVNADKLYWRYNGPSQPLKLLRKDTLAIGHLISTKAVLKWEREDITDTYKHAE 506
            |...:|..||||.||||.:.|..:  ::..:....|...:|..||||.....||||:|..||:.|
 Frog   302 IHLNYDAPFVFAMVNADCVSWIVS--TKGKEKYHCDPHLVGTQISTKRAGSDEREDLTHQYKYEE 364

  Fly   507 ---RSEEERSTMLKA------------LKQSRH-----------------AFSRY---YLNDNFN 536
               .:.|||....||            :.:|.|                 ..|||   ..|.|.|
 Frog   365 GINETAEERKAFEKAISRLHKGGAIPNINESEHMNGANGTSANGITPSPDESSRYTPQNENSNLN 429

  Fly   537 D------IEFDMELKDDIKIGQSFSVVLKVSNK-SESRTHMATGQISCDAV-------------- 580
            .      :....:|.:..::|::.|:||...|. |.::|...:  :|..|:              
 Frog   430 SPLREALLLLKFKLTESPQLGETISLVLLAGNMVSTAKTLKLS--LSAQAMKHDGKPAQQFWRDS 492

  Fly   581 LYTGVGAVEVKTLGFELELE-PKS-----------------------------SDYVRMEVIFEE 615
            :|..:|..|.:|....:.:| |||                             ..::..::.:.:
 Frog   493 MYVELGPHEAQTNSLWIVIELPKSLCKVTIPFIPFQLTQENEEGNLSPMFFYTEKWLLFKIPYAK 557

  Fly   616 YYDKLSSQAAFQISAAAKVKDTDYDYYAQDDFRVRKPDIKFQLGEAAIVAQKELDVILRLENPLP 680
            |...|......:..|..:...|......:.|..:..|.:.....|.|:| .|.....|...||:.
 Frog   558 YGPSLEDNHLIRFIAVGEQNITWEKVLVEKDVNLALPAVVINFLELAVV-DKTCKAELSFSNPIN 621

  Fly   681 IPLHKGVFTVEGPG-IEQPLKFKIAEIPVGGTAAATFKYTPPYAGRGTMLAKFTSKELDDVDGYR 744
            ..:|.....::|.| :::.:|..:..:..|..|...|::.|...|...:....:|.....:.|::
 Frog   622 EAIHDCQILIQGSGLLKKQVKLNMGTMKPGQKAVVAFEFVPWKVGYKQLQVNISSNRFKGLKGFK 686

  Fly   745 HYEIEP 750
            ...::|
 Frog   687 SVVVKP 692

Known Domains:


GeneSequenceDomainRegion External IDIdentity
TgNP_609174.1 Transglut_N 56..179 CDD:279240 17/120 (14%)
TGc 324..419 CDD:214673 49/95 (52%)
Transglut_C 538..644 CDD:279295 22/151 (15%)
Transglut_C 652..750 CDD:279295 19/99 (19%)
tgm5XP_017953286.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_2CD5G
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D153729at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 1 0.910 0.616 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.