DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Wwox and CG9265

DIOPT Version :10

Sequence 1:NP_609171.1 Gene:Wwox / 34090 FlyBaseID:FBgn0031972 Length:409 Species:Drosophila melanogaster
Sequence 2:NP_610081.3 Gene:CG9265 / 35369 FlyBaseID:FBgn0032910 Length:399 Species:Drosophila melanogaster


Alignment Length:125 Identity:39/125 - (31%)
Similarity:61/125 - (48%) Gaps:6/125 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly   117 KDLHGRTALITGANCGIGYETARSLAHHGCEIIFACRNRSSAEAAIERIAQERPAARSRCRFAAL 181
            |:|:...|||||...|:|...|..|...|.:::....|:......:: |.:|   |...|:...:
  Fly    82 KELNTDIALITGGGNGLGRLLAERLGKMGTKVVIWDINKKGIAETVQ-IVEE---AGGYCKGYVV 142

  Fly   182 DLSSLRSVQRFVEEIKQSVSHIDYLILNAGVFA-LPYTRTVDGL-ETTFQVSHLSHFYLT 239
            |:|....|.:..:.|:..|..|..||.||||.: |....|.|.| |.:|.|:.::||:.|
  Fly   143 DISKKEEVYKAADVIRDEVGDITLLINNAGVVSGLHLLDTPDHLIERSFNVNVMAHFWTT 202

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
WwoxNP_609171.1 WW 13..43 CDD:197736
human_WWOX_like_SDR_c-like 121..402 CDD:187669 37/121 (31%)
CG9265NP_610081.3 17beta-HSDXI-like_SDR_c 88..328 CDD:187598 37/119 (31%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.