DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: LanB1 and wb

Sequence 1:NP_476618.1 Gene:LanB1 FlyBaseID:FBgn0261800 Length:1788 Species:Drosophila melanogaster
Sequence 2:NP_723870.1 Gene:wb FlyBaseID:FBgn0261563 Length:3375 Species:Drosophila melanogaster

Alignment Length:2219 Identity:518/2220 (23%)
Similarity:786/2220 (35%) Gaps:686/2220 (31%)


  Fly    11 VLALLSWQWDPVDSQRPPQHGRRDRPKYPPN---------KFIKTHPCERSS----CYPATGNLL 62
            :||:.|  .:.|..::|||  ||...|...:         :.:||.....||    .||...|::
  Fly   101 MLAIAS--SESVTKKKPPQ--RRRNGKLQKSGGGAGGGALRLLKTEDVYSSSFSGGLYPPLFNVV 161

  Fly    63 IGRENRLTASSTCGLHSPERFCILSHLQDKKCFLCDTREETKHDPYKNHRIGQIIYK---TKPGT 124
              ...:::.::|||.:..|.:|  ..:..|.|.:|:....   |..|...|..:|..   :..|:
  Fly   162 --PRAQISVNATCGQNGAEEYC--KQVGAKPCGICNAHSS---DRAKQRSIQSLISSGSGSGSGS 219

  Fly   125 NIPT-WWQS---ENGK--ENATIQLDLEAEFH-FTHLIITFTTFRPAAMYIERSFDFGQTWHIYR 182
            .... ||||   :.|:  |..||.|||:..|. |:..:.:..:.|||:..:|:|.| |..:..::
  Fly   220 GFEEGWWQSPTLQGGRQFEYVTILLDLKQTFQIFSVWLKSANSPRPASWILEKSLD-GINFEPWQ 283

  Fly   183 YFAY---DCKE----SFPGVPTVLENITDVMCTSRYSNVEPSRNGEVIFRVLPPNINVTDPYAEH 240
            ||..   ||:.    |......|.:|.|:::|::::|...|..||.:...:|......||...| 
  Fly   284 YFGLSDADCQRRWNLSGQNGKYVFQNDTEIICSTQFSKPGPLENGVLHASLLKNRPGATDQSPE- 347

  Fly   241 VQNQLKMTNLRIQMTKLHKLG--DNLLDSRLEN---EEKYYYGISNMVVRGSCSCYGHASQCLPL 300
            :...:....:||::..:|...  ||.||..|::   |:..:|.:|.:.|.....|.|||::    
  Fly   348 LMKFITTRYIRIRLQGMHSTANQDNSLDWLLDSPSLEKHSFYSLSQLKVSARLDCNGHANR---- 408

  Fly   301 DPAFSQADNEDGMVHGRCECTHNTKGMNCEECEDFFNDLPWKPAFGKKTNACKKCECNDHAVSCH 365
                |....:|.::  :|.|.|||.|..||:|...|.|.|::..     ..|:.|:|..||.||.
  Fly   409 ----SHESPDDPLM--QCICQHNTCGAQCEQCCPLFQDRPYQMG-----GECEICQCYGHAESCT 462

  Fly   366 FDEAVFTASGFVSGGVCDNCLHNTRGQHCEECMPYFYRDPEQDITSERVCQPCDCDPQGSSDDGI 430
            :|.       |:..|:|.:|.:||.|..||.|...|||:.:..:|..  |.||.|:|..|:  |.
  Fly   463 YDP-------FLDKGICQSCSNNTAGIECEFCEMGFYRELDAPLTDP--CLPCSCNPARST--GG 516

  Fly   431 CDSLNELEEGAVAGACHCKAFVTGRRCNQCKDGYWNLQSDNPEGCEPCTCNPLGTLNNSG-CVMR 494
            |.|     :|   |:|:|.....|:.|.:|..||:.      :.|:.|.|:..|:|.::| |   
  Fly   517 CQS-----DG---GSCNCLEGFQGKNCEECAPGYYG------DDCKRCECDERGSLGSTGSC--- 564

  Fly   495 TGECKCKKYVTGKDCNQCMPETYGLS-ESPEGCSLCNCDAGGSYDNYCDVISGQC---------- 548
            :|.|:||..|.|..|::|.|..:.|| |:.|||:.|          :|..:|..|          
  Fly   565 SGVCQCKLNVEGSTCSECAPGYFDLSAENAEGCTSC----------WCSGVSQTCHSAKLQTLAF 619

  Fly   549 ------------RCRPHMTGRSCSQP---KQNYFIPLLPEVHEAEVV----------DECISYGA 588
                        |.:|      .|.|   :.|..| ...|:.|.|.:          :...|||:
  Fly   620 ETLNDWKITDIQRVKP------ISIPVDAETNRLI-FANELDEVEAIYWQASLGYLGNRLTSYGS 677

  Fly   589 ---------------------NGNCSLVA----------ETPDG-------SFTGIGFTRVPENS 615
                                 ..|..||.          |:.||       :.|.:|:..||.  
  Fly   678 RLQLVLSWDVIRGDRSGKPTTGPNVILVGKNGLKIAFGDESLDGLGINLNVTLTEVGWYHVPP-- 740

  Fly   616 ELVFTVGDIPRSMPYDAVIRYQSTSRGDWENAFITLVRPDQVDPEGGCGELAAATSSETRIPFSL 680
                ||.||.        .|.:.|..||:.                  ||      |.||..|  
  Fly   741 ----TVVDIK--------TRLRRTEGGDYH------------------GE------SVTRSQF-- 767

  Fly   681 PDRSRQVVALNEVCLEAGKVYKFRIYFERKRHDVDSPTATILVDSLTLIPRIDVTPIFQGSVLAD 745
               ...:|:|:.|.:.|.        |...:.:.....|.|....:.|          .|...:.
  Fly   768 ---LSVLVSLDAVLIRAA--------FHTDQGETSLERAVIYSGGVEL----------GGKSSSQ 811

  Fly   746 IRK----KDYEKYNCKSSLYDMN--YKSDPKCQNLDNILSVFVHDGASMCNCNPTGSLSKVCESN 804
            :.:    ..|...:|:...:...  |::....|.|...:.         |.||   ..|..|:..
  Fly   812 VEQCLCPAGYTGLSCEGCAFGFKRIYENTSDHQILSKCIP---------CPCN---GHSNSCDLQ 864

  Fly   805 GGYC-QCKPNVVGRQCDQCAPGTYG----FGPEGCKACDCNSIGSKD-------------KYCDL 851
            .|.| .|..|..|.:|::|..|.||    ..|..||.|.|..  |:|             .|.||
  Fly   865 SGNCGDCMHNTFGDRCERCQLGYYGNPLQGTPNDCKRCACPL--SEDSNNFSPSCQLKSYNYMDL 927

  Fly   852 ------------ITGQCQCVPNTY-GRECNQCQPGYWNFP-----ECRVCQCNGHAATCDPIQGT 898
                        |..||   |..| |..|..|..||:..|     .|:.|.|.|  ..|:...|.
  Fly   928 NPQFELIEHAEYICTQC---PEGYTGDHCQVCDDGYFGNPRQPGSSCQRCDCAG--GPCNVTTGE 987

  Fly   899 CIDCQDSTTGYSCDSCLDGYYGNPLFGSEIGCRPCRC-PETVASGLAHA-DGCSLDTRNNNMLCH 961
            ||.|:.:|.|:.|:.|..||:|:|    .:||.||.| .|...|||..: ||          .|.
  Fly   988 CITCRGNTEGWHCERCKLGYWGDP----AVGCDPCHCHTEGSESGLCDSTDG----------QCL 1038

  Fly   962 CQEGYSGSRCEICADNFFGNPDNGGTCSKCECSNNVDLYDTGNCDRQTGACLKCLYQTTGDHCEL 1026
            |:..|:|.:|:.| |..:.|.:.  .|..|.|.....|.. ..||..||.| .|.....|..|..
  Fly  1039 CKPRYAGQKCDEC-DVGYANVEL--RCPSCNCDPLGSLVQ-DRCDPHTGQC-HCKEGVMGAKCHE 1098

  Fly  1027 CKDGFFG-----------DALQQN------------------------CQQCECDFLGTNNTIAH 1056
            |:||:||           .||:||                        |::|.|..:|:.:  :.
  Fly  1099 CQDGYFGMNAVAYRMDDLAALRQNSDSDDDEWELVPDTEDPNSESTVACEECHCSSVGSLS--SD 1161

  Fly  1057 CDRFTGQCPCLPNVQGVRCDQCAENHWKIASGEGCESCNCDPIGALHEQCNSYTGQCQCKPGFGG 1121
            ||:.||||.||.||.|.|||:|...||.:.:||||..|.|||.|:...:||.:||||.||.|.||
  Fly  1162 CDKRTGQCACLANVTGRRCDKCRPGHWNLTAGEGCRDCRCDPHGSRGHECNPWTGQCDCKIGVGG 1226

  Fly  1122 RACNQCQAHYWGNPNEKCQ---------------------------------------------- 1140
            :.||:|...::|...|.||                                              
  Fly  1227 QHCNECTEGFFGFSTEGCQRCSACRSEGQVCDPHNGRCICPKFTRGLGCGQCVPGTWGWQARLGC 1291

  Fly  1141 -PCECDQFGAADFQCDRETGNCVCHEGIGGYKCNECARGYIGQFPHCSPCG-------------- 1190
             .||||..|:...||....|.|.|.||..|.||:.||.||.| :|.|..||              
  Fly  1292 RECECDHIGSIGQQCSTGDGQCQCREGYSGRKCDTCAIGYFG-YPECRRCGCDAEGSFTQADGSI 1355

  Fly  1191 ECFNNW-----DLILSALEDATTATILRAKEIKQVGATGAY----TSEFSELDKKLQHI-----R 1241
            .|.:|.     .|::....|....:..........|.|..:    :.|..:.|....||     |
  Fly  1356 ACDSNGQCPCKSLVVGLKCDTCMQSTFGLSAQNPEGCTRCFCFGRSGECEQSDLSWGHIRMAESR 1420

  Fly  1242 NL----LQNTSVSLVDIEKL-------------DYETQSLRD--QLQASHGRLS----------- 1276
            ||    ::..||...|.|.:             |.|.|.:.|  .:..|.|.:|           
  Fly  1421 NLSVQQIRPHSVPSSDYEYIVVVQMEGSSFHREDAEIQRMNDLSLVPKSTGNVSIGAYGQFYHPL 1485

  Fly  1277 -----------ETEQNLDDIYNSLSLSGVE------------LESLQNHSRLV------QQLSKE 1312
                       .|......:|.:|...|..            |..|..||:|:      ::....
  Fly  1486 YFQLPPQFYGDRTSSYGGFLYFTLITEGAHKPLERNILGQYPLVQLHAHSKLLLDFYEYEEFEYS 1550

  Fly  1313 LK-ENGIQLQES--------------NIEGALNLTRHAYER-----------VSNLST-----LK 1346
            |. .:.:.|.||              .:..||...||.:.|           :.|:..     :|
  Fly  1551 LNVTHRVPLHESFWKYHHTSQAVDRNTLMAALQNIRHIFIRAFAFADFQEVVLQNVHMDAAIYIK 1615

  Fly  1347 DEANELASNTDR-NC-KRVENLSNKIQAEADDLANNNKLIEDY-------RAELTSLTSQIPELN 1402
            ...|.:|...:| .| ||.:.||.:....:.....|..::|..       ||.......:..:.:
  Fly  1616 GSTNLIAKGVERCKCPKRFDGLSCQDPGRSFYRWRNTTIVESVFIEDLIGRAAPCHCNGRSSDCD 1680

  Fly  1403 NQ--VC-----GKPGDPCDSLCGG------------------------AGCGHCGGFLSC----- 1431
            .:  ||     ...||.|.....|                        .||....|.:||     
  Fly  1681 RETGVCQNCRGNTGGDHCHQCAEGFYGDPNSPHGCQACPCPETNRNFARGCNVWDGEVSCVCKPG 1745

  Fly  1432 -------------------------------EHGAKTHS---EEALKVAKDAETAITSKKDQADQ 1462
                                           ..|.:|..   |......::..|.:...|.||::
  Fly  1746 YTGRLCERCQAGYFGDPMRYPNTTCQPCNCHPDGIQTEGCDVETGRCYCREGVTGLKCDKCQAER 1810

  Fly  1463 --------------TIRALTQAKLNASE-------------------------AYEK---AKRGF 1485
                          |:..|...:|..::                         ||||   ....|
  Fly  1811 HHLVDNGCKICDNCTLLLLDYMELVGNKLRRGMHNMDLTGIPAPYRKLSEYESAYEKWNGRHWDF 1875

  Fly  1486 EQSERYLNQTNAN--IKL---AENLFIALNNFQENKTASPSESKELAQKTLDLDLKLEPEEIETL 1545
            .|::|.|...::.  :||   ||||     .||..|..:....:|.|.|::..|...:...:..|
  Fly  1876 SQTKRRLQDYDSADILKLEAHAENL-----KFQSRKAVATIGKREFAIKSMREDAVTQQHSVGLL 1935

  Fly  1546 GDQINRAVSSLKNV-EAIIYRTKPDLDRVNNLQSIANATKEKADKILDSANSVVESLAAADESQG 1609
            ..:|.:.:|.|... ::..|.:.|  ..:...:....|.:|. |:::....|..:.......:.|
  Fly  1936 RSEILQTLSDLHGYGKSAHYLSLP--TALKQARFYLQAIREH-DQMVQGIRSTNDCAWKHFYAMG 1997

  Fly  1610 KAKDAIQQANSNIELAGQDLEKID----------EETYSAEAPANNTAQQVEKLAKKV----QKL 1660
            .|.||....:..:|:..:||.:.:          :.....|..|.:..:.|..|:.:|    |:|
  Fly  1998 NASDASFDESGRLEMLWRDLNQTNHRVVDMRLQVDRVQEVENEAEDVLEHVRNLSIRVGESHQEL 2062

  Fly  1661 Q--NNIMKNDRDAKEITKEAGSVKLEAMR---ARGEANNLQSATSATNQTLTDRASRSENARERA 1720
            .  |..:.:..|...:.:..|.::|...|   ..|..|.|.......|.||   ..::|..||..
  Fly  2063 DELNQRISDHLDPGYLEQGEGLLRLTVQRQIMLNGHLNQLDGYRILLNTTL---GVKTEQQREVR 2124

  Fly  1721 KQLLQRASK 1729
            |..|.:|.|
  Fly  2125 KHWLPKAEK 2133

Known Domains:


GeneSequenceDomainRegion External IDIdentity
LanB1NP_476618.1 Laminin_N 63..286 CDD:278484 62/245 (25%)
EGF_Lam 287..343 CDD:238012 18/56 (32%)
Laminin_EGF 355..415 CDD:278482 21/60 (35%)
Laminin_EGF 418..475 CDD:278482 16/57 (28%)
EGF_Lam 477..526 CDD:238012 20/51 (39%)
EGF_Lam 529..567 CDD:214543 9/63 (14%)
EGF_Lam 789..834 CDD:214543 16/50 (32%)
Laminin_EGF 837..885 CDD:278482 20/79 (25%)
Laminin_EGF 883..930 CDD:278482 17/47 (36%)
Laminin_EGF 933..988 CDD:278482 16/57 (28%)
Laminin_EGF 991..1043 CDD:278482 21/87 (24%)
Laminin_EGF 1043..1091 CDD:278482 23/48 (48%)
Laminin_EGF 1094..1142 CDD:278482 23/95 (24%)
Laminin_EGF 1142..1190 CDD:278482 23/48 (48%)
COG6 1212..>1398 CDD:303003 52/294 (18%)
TelA 1439..1782 CDD:226371 71/362 (20%)
ApoLp-III_like 1545..1702 CDD:304399 32/177 (18%)
wbNP_723870.1 Laminin_N 164..396 CDD:278484 61/239 (26%)
EGF_Lam 401..450 CDD:238012 19/64 (30%)
TNFRSF <407..507 CDD:304602 39/124 (31%)
EGF_Lam 505..552 CDD:238012 19/63 (30%)
Laminin_EGF 550..597 CDD:278482 20/50 (40%)
Laminin_B 660..798 CDD:278481 34/189 (18%)
EGF_Lam 851..900 CDD:238012 17/61 (28%)
Laminin_EGF <943..971 CDD:278482 10/31 (32%)
VSP 953..1414 CDD:146106 143/485 (29%)
Laminin_EGF 974..1018 CDD:278482 19/50 (38%)
EGF_Lam 1017..1065 CDD:238012 18/61 (30%)
Laminin_EGF 1065..>1105 CDD:278482 15/42 (36%)
EGF_Lam 1150..1197 CDD:238012 24/49 (49%)
Laminin_EGF 1199..1247 CDD:278482 23/48 (48%)
EGF_Lam 1247..1292 CDD:238012 0/45 (0%)
Laminin_EGF 1294..1342 CDD:278482 24/49 (49%)
Laminin_EGF 1340..1392 CDD:278482 7/52 (13%)
Laminin_B 1486..1611 CDD:278481 19/125 (15%)
EGF_Lam 1669..1716 CDD:238012 6/47 (13%)
Laminin_EGF 1718..1767 CDD:278482 5/49 (10%)
EGF_Lam 1772..1819 CDD:238012 7/47 (15%)
CrfC <1933..2267 CDD:223771 42/208 (20%)
Laminin_II 2277..2400 CDD:283628
LamG 2399..>2492 CDD:304605
Laminin_G_2 2616..2755 CDD:280389
Laminin_G_2 2804..2944 CDD:280389
Laminin_G_2 3038..3169 CDD:280389
LamG 3192..3347 CDD:238058
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C129936489
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000046
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR10574
RoundUp 00.000 Not matched by this tool.
33.030

Return to query results.
Submit another query.