DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: r2d2 and PRKRA

Sequence 1:NP_001162903.1 Gene:r2d2 FlyBaseID:FBgn0031951 Length:311 Species:Drosophila melanogaster
Sequence 2:NP_003681.1 Gene:PRKRA HGNCID:9438 Length:313 Species:Homo sapiens

Alignment Length:182 Identity:47/183 (26%)
Similarity:80/183 (44%) Gaps:30/183 (16%)


  Fly     4 KSAVSALQEF-----------CART--QINLPTYSFIPGEDGGYVCKVELLEIEALGNGRSKRDA 55
            |:.:..|.|:           |.|:  ||::||::|          :|.:.:|...|.|.||:.|
Human    33 KTPIQVLHEYGMKTKNIPVYECERSDVQIHVPTFTF----------RVTVGDITCTGEGTSKKLA 87

  Fly    56 KHLAASNILRKIQLLPGIHGLMKDSTVGDLDEELTN-LNRDMVKELRDYCVRREMPLPCIEVVQQ 119
            ||.||...:..::....|...:.|..:.|..::..| ||  .:..|::..:.....||...:.|:
Human    88 KHRAAEAAINILKANASICFAVPDPLMPDPSKQPKNQLN--PIGSLQELAIHHGWRLPEYTLSQE 150

  Fly   120 SGTPSAPEFVACCSVASIVRYGKSDKKKDARQRAAIEMLALISSNSDNLRPD 171
            .|.....|:...|.:.|.:..||...||.|::.||.:.||..|    |:.|:
Human   151 GGPAHKREYTTICRLESFMETGKGASKKQAKRNAAEKFLAKFS----NISPE 198

Known Domains:


GeneSequenceDomainRegion External IDIdentity
r2d2NP_001162903.1 DSRM 6..67 CDD:238007 20/74 (27%)
DSRM 95..158 CDD:238007 15/63 (24%)
PRKRANP_003681.1 Sufficient for self-association and interaction with TARBP2 1..103 21/80 (26%)
DSRM 35..100 CDD:214634 20/75 (27%)
Sufficient for self-association and interaction with TARBP2 102..195 25/99 (25%)
DSRM 126..192 CDD:238007 18/68 (26%)
Sufficient for self-association and interaction with TARBP2 195..313 1/5 (20%)
DSRM 241..307 CDD:214634
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3732
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1093169at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR46205
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.