DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment r2d2 and STAU1

DIOPT Version :9

Sequence 1:NP_001162903.1 Gene:r2d2 / 34066 FlyBaseID:FBgn0031951 Length:311 Species:Drosophila melanogaster
Sequence 2:NP_001309861.1 Gene:STAU1 / 6780 HGNCID:11370 Length:583 Species:Homo sapiens


Alignment Length:183 Identity:46/183 - (25%)
Similarity:84/183 - (45%) Gaps:22/183 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 GNGRSKRDAKHLAASNILRKIQLLPGIHGLMKDSTVGDLDEELTNLNRDMVKELRDYCVRREMPL 111
            |.|::::.|||.||:..||.:|..|    |.:...|...:.|..|||:..:.::.:..::|.:|:
Human   140 GKGKTRQAAKHDAAAKALRILQNEP----LPERLEVNGRESEEENLNKSEISQVFEIALKRNLPV 200

  Fly   112 -----PCIEVVQQSGTPSAPEFVACCSVASIVRYGKSDKKKDARQRAAIEMLALISSNSDNLRPD 171
                 |..:|.::||.|....||...||...|..|:...||.:::.|||.:|..:.........:
Human   201 NFESFPLKQVARESGPPHMKNFVTKVSVGEFVGEGEGKSKKISKKNAAIAVLEELKKLPPLPAVE 265

  Fly   172 QMQVASTSKLK-VVDMEESME------------ELEALRRKKFTTYWELKEAG 211
            :::.....|.| :|..:.|.|            :::..:::|...|..|.|.|
Human   266 RVKPRIKKKTKPIVKPQTSPEYGQGINPISRLAQIQQAKKEKEPEYTLLTERG 318

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
r2d2NP_001162903.1 DSRM 6..67 CDD:238007 9/19 (47%)
DSRM 95..158 CDD:238007 18/67 (27%)
STAU1NP_001309861.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 34..55
DSRM 186..256 CDD:214634 19/69 (28%)
DSRM 292..358 CDD:238007 5/27 (19%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 366..403
Staufen_C 454..563 CDD:293091
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3732
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.