DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Herp and Herpud1

Sequence 1:NP_609151.2 Gene:Herp FlyBaseID:FBgn0031950 Length:465 Species:Drosophila melanogaster
Sequence 2:NP_445975.1 Gene:Herpud1 RGDID:620818 Length:391 Species:Rattus norvegicus

Alignment Length:487 Identity:134/488 (27%)
Similarity:194/488 (40%) Gaps:149/488 (31%)


  Fly    22 QKNPETSVRLLIKSSNQQYEDLNVDSDLCWTVQRLKKHLSLIYPGKPLIQDQKLIYSGKLLDDSQ 86
            :..|| .|.||:||.||::.||.:..|..|:|.|||.|||.:||.:|..:||:||||||||.|.|
  Rat     4 EPQPE-PVTLLVKSPNQRHRDLELSGDRGWSVSRLKAHLSRVYPERPRPEDQRLIYSGKLLLDHQ 67

  Fly    87 KISEVIRSYKDVYQQHHIFHLVCASKQVIRPAAKAPTVPQKDAVPA-GPEVTGNA--------NE 142
            .:.:::..    .::.|:.||||.    :|..:|.|....|.|... .|:.|..|        :.
  Rat    68 CLQDLLPK----QEKRHVLHLVCN----VRSPSKKPEASTKGAESTEQPDNTSQAQYPGDSSSDG 124

  Fly   143 LRQRHAPHQ---------------QQAQQGNAGPHVTGDIGLANPWTHFWQQSQGAAPAANASAS 192
            ||:|.....               ||..|| .||      |.:...|:.|.|.            
  Rat   125 LREREVLRNLPPSGWENVSRPEAVQQTFQG-LGP------GFSGYTTYGWLQL------------ 170

  Fly   193 PHALFQQQALIYNAWMQQAYAQ--YMQQLTLRSTLPGSNQSGLPPPTQPLLPSVPLIA------- 248
                         :|.||.||:  |||.|...:.      ||...|| |....:|:::       
  Rat   171 -------------SWFQQIYARQYYMQYLAATAA------SGAFGPT-PSAQEIPVVSTPAPAPI 215

  Fly   249 GRNFGEVQQVAGAAAAPAAQVPADPQINGAPQN-----RNFPNIQEEPEMH-DWLDSFFSFTRLA 307
            ...|....|.|...|  |||...:|   ||.||     :..|.::|:.|:: ||||..:|....:
  Rat   216 HNQFPAENQPANQNA--AAQAVVNP---GANQNLRMNAQGGPLVEEDDEINRDWLDWTYSAATFS 275

  Fly   308 IFVTVLYFNSSALRCLLVVLIAGAIYLYHIGVLRRRRERNNNNINRNNNAGDAAAFAAVQQIQRM 372
            :|:::|||.||..|.|:|:.....:||:|:|....|:                      :.:|..
  Rat   276 VFLSILYFYSSLSRFLMVMGATVVMYLHHVGWFPFRQ----------------------RPVQNF 318

  Fly   373 MD------AAVQRENNDPQAANEPGAVPAAGPAAAGEQDAIDAPPAGAPVAPASAANPEPTDVSA 431
            .|      ||.|..||:.|...:|                             ...:|....|..
  Rat   319 PDDGPPQEAANQDPNNNLQGGLDP-----------------------------EMEDPNRLPVGR 354

  Fly   432 EAVEPPNANNSVISVVRTFVITFFTSLLPEAP 463
            |.::|.:.:.|.:|.......|||.|||||.|
  Rat   355 EVLDPEHTSPSFMSTAWLVFKTFFASLLPEGP 386

Known Domains:


GeneSequenceDomainRegion External IDIdentity
HerpNP_609151.2 Herp_N 28..110 CDD:176385 38/82 (46%)
UBQ 29..110 CDD:214563 38/81 (47%)
Herpud1NP_445975.1 Herp_N 9..87 CDD:176385 38/82 (46%)
UBQ 10..86 CDD:214563 37/80 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C137909408
eggNOG 1 0.900 E1_KOG4583
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 134 1.000 Inparanoid score I4422
OMA 1 1.010
OrthoDB 1 1.010 D1251727at2759
OrthoFinder 1 1.000 FOG0002266
OrthoInspector 1 1.000 T618833
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR12943
Phylome 00.000 Not matched by this tool.
TreeFam 1 0.960
109.960

Return to query results.
Submit another query.