DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Herp and Herpud2

Sequence 1:NP_609151.2 Gene:Herp FlyBaseID:FBgn0031950 Length:465 Species:Drosophila melanogaster
Sequence 2:NP_065611.1 Gene:Herpud2 MGIID:1915393 Length:404 Species:Mus musculus

Alignment Length:490 Identity:140/491 (29%)
Similarity:205/491 (42%) Gaps:141/491 (29%)


  Fly    22 QKNPETSVRLLIKSSNQQYEDLNVDSDLCWTVQRLKKHLSLIYPGKPLIQDQKLIYSGKLLDDSQ 86
            |...|..|.|:||:.||:|.|..:...|.|||.:||.|||.:||.|||.:||:|:|||:||.|..
Mouse     3 QSGMEIPVTLIIKAPNQKYSDQTISCFLNWTVGKLKTHLSNVYPSKPLTKDQRLVYSGRLLPDHL 67

  Fly    87 KISEVIRSYKDVYQQHHIFHLVCASKQVIRPAAKAPTVPQ---------------------KDAV 130
            ::.:::|.    ..::|:.||||||:       ..|:.|:                     .|:.
Mouse    68 QLKDILRK----QDEYHMVHLVCASR-------SPPSSPKSSTDRGSHEALASSTSSNSDHSDST 121

  Fly   131 PAGPE------VTGNANELRQRHAPHQQQAQQGNAGPH-----VTGDIGLANPWTHFWQQSQGAA 184
            ...|.      |||::..||||..   .|||...|..|     :.|::....|       .||..
Mouse   122 TPSPSQESLSLVTGSSEGLRQRTL---SQAQTDPAQSHQFPYVIQGNVDHQFP-------GQGVP 176

  Fly   185 PA--ANASASPHALFQQQALIYNAWMQQAYAQ--YMQ-QLTLRSTLPGSNQSGLPPPTQPLLPSV 244
            ||  ...:.||         :...|.||.||.  ||| |..:.:....|..|.....:.||    
Mouse   177 PAFPVYPALSP---------LQMLWWQQMYAHQYYMQYQAAVSAQATSSAGSAQRAASSPL---- 228

  Fly   245 PLIAGRNFGEVQQVAGAAAAPAAQVPADPQINGAPQNRNF-------PNIQEEPEMHDWLDSFFS 302
                     .:..|.|....||..:.|  |.|| |.|.|.       |.:.||....||||..::
Mouse   229 ---------NLAHVPGEEPPPAPNLVA--QENG-PMNENVQMNAQGGPVLNEEDLNRDWLDWVYT 281

  Fly   303 FTRLAIFVTVLYFNSSALRCLLVVLIAGAIYLYHIGVLRRRRERNN----NNINRNNNAGDAAAF 363
            |:|.|:.::::||.||..|.::|:.....:||:..|....|:|...    ||::.||: |..|..
Mouse   282 FSRAAVLLSIVYFYSSFSRFIMVMGAMLLVYLHQAGWFPFRQEGGQQQAPNNVDANND-GHNANN 345

  Fly   364 AAVQQIQRMMDAAVQRENNDPQAANEPGAVPAAGPAAAGEQDAIDAPPAGAPVAPASAANPEPTD 428
            ..:::::|:||..::.|:.:.                |||    ||..|..|...|||       
Mouse   346 LELEEMERLMDDGLEDESGED----------------AGE----DASAAQRPGLMASA------- 383

  Fly   429 VSAEAVEPPNANNSVISVVRTFVITFFTSLLPEAP 463
                               .:|:.||||||:||.|
Mouse   384 -------------------WSFITTFFTSLIPEGP 399

Known Domains:


GeneSequenceDomainRegion External IDIdentity
HerpNP_609151.2 Herp_N 28..110 CDD:176385 37/82 (45%)
UBQ 29..110 CDD:214563 37/81 (46%)
Herpud2NP_065611.1 Herp_N 9..87 CDD:176385 37/82 (45%)
UBQ 10..87 CDD:214563 37/81 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C137912606
eggNOG 1 0.900 E1_KOG4583
Hieranoid 1 1.000
Homologene 1 1.000 H10756
Inparanoid 1 1.050 141 1.000 Inparanoid score I4441
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D1251727at2759
OrthoFinder 1 1.000 FOG0002266
OrthoInspector 1 1.000 T616711
orthoMCL 1 0.900 OOG5_132728
Panther 1 1.100 LDO PTHR12943
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R4127
TreeFam 1 0.960
1312.890

Return to query results.
Submit another query.