DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Herp and Herpud1

Sequence 1:NP_609151.2 Gene:Herp FlyBaseID:FBgn0031950 Length:465 Species:Drosophila melanogaster
Sequence 2:NP_071726.1 Gene:Herpud1 MGIID:1927406 Length:391 Species:Mus musculus

Alignment Length:484 Identity:138/485 (28%)
Similarity:198/485 (41%) Gaps:143/485 (29%)


  Fly    22 QKNPETSVRLLIKSSNQQYEDLNVDSDLCWTVQRLKKHLSLIYPGKPLIQDQKLIYSGKLLDDSQ 86
            :..|| .|.||:||.||::.||.:..|..|:|.|||.|||.:||.:|..:||:||||||||.|.|
Mouse     4 EPQPE-PVTLLVKSPNQRHRDLELSGDRSWSVSRLKAHLSRVYPERPRPEDQRLIYSGKLLLDHQ 67

  Fly    87 KISEVIRSYKDVYQQHHIFHLVCASKQVIRPAAKAPTVPQKDAVPAGPEVTGNANE--------- 142
            .:.:::..    .::.|:.||||.    ::..:|.|....|.|  ...|...|:|:         
Mouse    68 CLQDLLPK----QEKRHVLHLVCN----VKNPSKMPETSTKGA--ESTEQPDNSNQTQHPGDSSS 122

  Fly   143 --LRQRHAPHQ---------------QQAQQGNAGPHVTGDIGLANPWTHFWQQSQGAAPAANAS 190
              ||||.....               ||..|| .||      |.:...|:.|.|.          
Mouse   123 DGLRQREVLRNLSPSGWENISRPEAVQQTFQG-LGP------GFSGYTTYGWLQL---------- 170

  Fly   191 ASPHALFQQQALIYNAWMQQAYAQ--YMQQLTLRSTLPGSNQSG--LPPPTQPLLPSV----PLI 247
                           :|.||.||:  |||.|...:.      ||  :|.|:...:|.|    |..
Mouse   171 ---------------SWFQQIYARQYYMQYLAATAA------SGTFVPTPSAQEIPVVSTPAPAP 214

  Fly   248 AGRNFGEVQQVAGAAAAPAAQVPADPQINGAPQN-----RNFPNIQEEPEMH-DWLDSFFSFTRL 306
            ....|....|.|...|  |||...:|   ||.||     :..|.::|:.|:: ||||..:|....
Mouse   215 IHNQFPAENQPANQNA--AAQAVVNP---GANQNLRMNAQGGPLVEEDDEINRDWLDWTYSAATF 274

  Fly   307 AIFVTVLYFNSSALRCLLVVLIAGAIYLYHIG--VLRRRRERNNNNINRNNNAGDAAAFAAVQQI 369
            ::|:::|||.||..|.|:|:.....:||:|:|  ..|:|..:     |..::.|.          
Mouse   275 SVFLSILYFYSSLSRFLMVMGATVVMYLHHVGWFPFRQRPVQ-----NFPDDGGP---------- 324

  Fly   370 QRMMDAAVQRENNDPQAANEPGAVPAAGPAAAGEQDAIDAPPAGAPVAPASAANPEPTDVSAEAV 434
               .|||.|..||:.|...:|..           :|....||                  ..|.:
Mouse   325 ---RDAANQDPNNNLQGGMDPEM-----------EDPNRLPP------------------DREVL 357

  Fly   435 EPPNANNSVISVVRTFVITFFTSLLPEAP 463
            :|.:.:.|.:|.......|||.|||||.|
Mouse   358 DPEHTSPSFMSTAWLVFKTFFASLLPEGP 386

Known Domains:


GeneSequenceDomainRegion External IDIdentity
HerpNP_609151.2 Herp_N 28..110 CDD:176385 38/82 (46%)
UBQ 29..110 CDD:214563 38/81 (47%)
Herpud1NP_071726.1 Herp_N 9..87 CDD:176385 38/82 (46%)
UBQ 10..86 CDD:214563 37/80 (46%)
Interaction with UBQLN1. {ECO:0000250|UniProtKB:Q15011} 115..200 27/123 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C137902757
eggNOG 1 0.900 E1_KOG4583
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 141 1.000 Inparanoid score I4441
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0002266
OrthoInspector 1 1.000 T616711
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR12943
Phylome 1 0.910 0.750 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R4127
TreeFam 1 0.960
109.880

Return to query results.
Submit another query.