DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Herp and herpud1

Sequence 1:NP_609151.2 Gene:Herp FlyBaseID:FBgn0031950 Length:465 Species:Drosophila melanogaster
Sequence 2:XP_005159177.1 Gene:herpud1 ZFINID:ZDB-GENE-050913-47 Length:408 Species:Danio rerio

Alignment Length:499 Identity:137/500 (27%)
Similarity:204/500 (41%) Gaps:169/500 (34%)


  Fly    28 SVRLLIKSSNQQYEDL---NVDSDLCWTVQRLKKHLSLIYPGKPLIQDQKLIYSGKLLDDSQKIS 89
            ::.|:||:.||.:.|.   .|.:|  |||:.||.|||.:||..|..:||:||||||||.|:..| 
Zfish    11 TISLVIKTPNQFHGDQLIEGVRAD--WTVKDLKCHLSKVYPNNPAEKDQRLIYSGKLLLDNLLI- 72

  Fly    90 EVIRSYKDVYQQ-----HHIFHLVCASKQVIRPAAKAPTVPQKDAVPAGPEVTGNANELRQRHAP 149
                  :||:.:     ....|||||.:.  :||::         :.|.|:||          :.
Zfish    73 ------RDVFSKVPSDTKPTLHLVCAVRP--QPASQ---------LGARPKVT----------ST 110

  Fly   150 HQQQAQQG------NAGPHVT---GDIGLANPWTHFWQQSQGAAP--AANASA-----------S 192
            |||.:|..      ::||.||   ...||.       |:.....|  :||.||           .
Zfish   111 HQQSSQPSPLTPSQSSGPSVTSLHSTDGLR-------QRGHATLPDTSANTSAPVTAAMNHPAFP 168

  Fly   193 PHALFQQQALIYNAWMQQAYAQ--YMQ-QLTLRSTLPGSNQSGLPPPTQPLLPSVPLIAGRNFGE 254
            .::|:..|.|:   |:||.||:  ||| |..:.:.      :..|..|.....|:|:      |.
Zfish   169 TYSLYSPQQLL---WLQQMYARQYYMQYQAAMAAA------ASAPMTTPAAASSLPV------GP 218

  Fly   255 VQQVAGAAAAPAAQVPADPQINGAPQNRNFPN----------------------IQEEPEMH-DW 296
            .|     ||.||| :|....||..|.|:|.|.                      :::|.:|: ||
Zfish   219 HQ-----AAVPAA-LPNQGPINDLPANQNAPGPAFINPEGANQNLRMNAQGGPVVEDEEDMNRDW 277

  Fly   297 LDSFFSFTRLAIFVTVLYFNSSALRCLLVVLIAGAIYLYHIG--VLRRRRERNNNN-----INRN 354
            ||..::.:||.:|::::||.||..|.:||:.....:||:..|  ..|:|.:....|     :|:|
Zfish   278 LDWMYTASRLGVFLSIVYFYSSMSRFILVMSSLVIMYLHTAGWFPFRQRPQARPQNEPAPEVNQN 342

  Fly   355 NNAGDAAAFAAVQQIQRMMDAAVQRENNDPQAANEPGAVPAAGPAAAGEQDAIDAPPAGAPVAPA 419
            ...                    |.|:..|:        |.|.||...:...:|         ||
Zfish   343 QQN--------------------QNEDQHPE--------PVAPPAEVEDVGVVD---------PA 370

  Fly   420 SAANPEPTDVSAEAVEPPNANNSVISVVRTFVITFFTSLLPEAP 463
            ..|.|.|      .|..|     ::.....|...||.||:||.|
Zfish   371 MTAVPVP------QVRAP-----ILWTAWVFFKAFFASLIPEPP 403

Known Domains:


GeneSequenceDomainRegion External IDIdentity
HerpNP_609151.2 Herp_N 28..110 CDD:176385 37/90 (41%)
UBQ 29..110 CDD:214563 37/89 (42%)
herpud1XP_005159177.1 UBQ 12..92 CDD:294102 37/89 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C137906737
eggNOG 1 0.900 E1_KOG4583
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 140 1.000 Inparanoid score I4405
OMA 1 1.010
OrthoDB 1 1.010 D1251727at2759
OrthoFinder 1 1.000 FOG0002266
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR12943
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R4127
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
109.990

Return to query results.
Submit another query.