DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Herp and herpud1

Sequence 1:NP_609151.2 Gene:Herp FlyBaseID:FBgn0031950 Length:465 Species:Drosophila melanogaster
Sequence 2:NP_998846.1 Gene:herpud1 XenbaseID:XB-GENE-922358 Length:370 Species:Xenopus tropicalis

Alignment Length:384 Identity:108/385 (28%)
Similarity:165/385 (43%) Gaps:97/385 (25%)


  Fly    29 VRLLIKSSNQQYEDLNVDSDLCWTVQRLKKHLSLIYPGKPLIQDQKLIYSGKLLDDSQKISEVIR 93
            |.|||:|.:.:.|:..:.:....||:.||..|....||:|:.|||:|||:||||.|..|::||:.
 Frog     6 VTLLIRSPSLRQEEREISAPRNCTVRELKTQLRQELPGEPMEQDQRLIYAGKLLPDHLKLNEVLS 70

  Fly    94 SYKDVYQQHHIFHLVCASKQVIRPAAKAPTVPQKDAVPAGPE-VTGNANELRQRHAPHQQQAQQG 157
                 .:..|:.||||:.:..:.....:...|  ....|.|. |...|:.:|||..|....|...
 Frog    71 -----MESRHVLHLVCSKRIPLNQTQDSSQHP--GCSSAQPHTVNSEADGIRQRILPQSNSADGS 128

  Fly   158 NAGPHVTGDIGLANPWTHFWQQSQGAAPAANASASPHALFQQQALIYNAWMQQAYAQ--YMQQLT 220
            |.                  .:.|||:||.:|    :.::..|.::   |:|..||:  |||...
 Frog   129 NT------------------SRPQGASPAFSA----YPVYSPQQIM---WLQHMYARQYYMQYYA 168

  Fly   221 LRSTLPGSNQSGLPPPTQPLLPSVPLIAGRNFGEVQQVAGAAAAPAAQVPADPQINGAPQN--RN 283
            ..:.....:|.|...|..|  |:.|......|            ||...|.:|::. ||.|  .|
 Frog   169 AAAAGRSPSQRGQEIPVVP--PAAPDPLPHPF------------PANNQPQNPEVQ-APVNPVAN 218

  Fly   284 FPN---------IQEEPEMH-DWLDSFFSFTRLAIFVTVLYFNSSALRCLLVVLIAGAIYLYHIG 338
             ||         ::||.::| ||||..::..|.:||:::|||.||..|.::|:.....:||:|.|
 Frog   219 -PNLRMNAQGGLVEEEDDVHRDWLDWIYTAARFSIFLSILYFYSSLSRFMMVLGAMILMYLHHAG 282

  Fly   339 VLRRR-----RERNNNNI---------NRNNNAGDAAAFAAVQQIQRMMDAAVQRENND 383
            ....|     .|..|.||         ::|||                    :|:|.||
 Frog   283 WFPFRPRPAPEEAANVNIPPMAAPNHQDQNNN--------------------LQQEEND 321

Known Domains:


GeneSequenceDomainRegion External IDIdentity
HerpNP_609151.2 Herp_N 28..110 CDD:176385 33/81 (41%)
UBQ 29..110 CDD:214563 33/81 (41%)
herpud1NP_998846.1 UBQ 5..82 CDD:320785 33/81 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C137906442
eggNOG 1 0.900 E1_KOG4583
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D1251727at2759
OrthoFinder 1 1.000 FOG0002266
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
65.810

Return to query results.
Submit another query.