DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Herp and Herpud2

Sequence 1:NP_609151.2 Gene:Herp FlyBaseID:FBgn0031950 Length:465 Species:Drosophila melanogaster
Sequence 2:XP_006242785.1 Gene:Herpud2 RGDID:1307343 Length:402 Species:Rattus norvegicus

Alignment Length:486 Identity:136/487 (28%)
Similarity:204/487 (42%) Gaps:135/487 (28%)


  Fly    22 QKNPETSVRLLIKSSNQQYEDLNVDSDLCWTVQRLKKHLSLIYPGKPLIQDQKLIYSGKLLDDSQ 86
            |...|..|.|:||:.||:|.|..:...|.|||.:||.|||.:||.|||.:||:|:|||:||.|..
  Rat     3 QSGMEIPVTLIIKAPNQKYSDQTISCFLNWTVGKLKTHLSNVYPSKPLTKDQRLVYSGRLLPDHL 67

  Fly    87 KISEVIRSYKDVYQQHHIFHLVCASKQVIRPAAKAPTVPQ---------------------KDAV 130
            ::.:::|.    ..::|:.||||||:       ..|:.|:                     .|:.
  Rat    68 QLKDILRK----QDEYHMVHLVCASR-------SPPSSPKSSTDGESHGALASSTNSNSDHSDST 121

  Fly   131 PAGPE------VTGNANELRQRHAPHQQQAQQGNAGPH-----VTGDIGLANPWTHFWQQSQGAA 184
            ...|.      |.|::..||.|..|   |||...|..|     :.|::....|       .||..
  Rat   122 TPSPSQESLSLVAGSSEGLRHRTLP---QAQTDPAQSHQFPYVIQGNVDHQFP-------GQGVP 176

  Fly   185 PAANASASPHALFQQQALIYNAWMQQAYAQ--YMQ-QLTLRSTLPGSNQSGLPPPTQPLLPSVPL 246
            |.       ..::...:.:...|.||.|||  ||| |..:.:....|..|.....:.||      
  Rat   177 PG-------FPMYPAFSPLQMLWWQQMYAQQYYMQYQAAVTAQATSSASSAQHAASSPL------ 228

  Fly   247 IAGRNFGEVQQVAGAAAAPAAQVPADPQINGAPQN-----RNFPNIQEEPEMHDWLDSFFSFTRL 306
                   .:..|.|....||..:.|  |.|| |:|     :..|.:.||....||||..::|:|.
  Rat   229 -------NLAHVPGEEPPPAPNLVA--QENG-PENVQMNAQGGPVLNEEDFNRDWLDWVYTFSRA 283

  Fly   307 AIFVTVLYFNSSALRCLLVVLIAGAIYLYHIGVLRRRRERNN----NNINRNNNAGDAAAFAAVQ 367
            |:.::::||.||..|.::|:.....:||:..|....|:|...    ||::.||. |..|....::
  Rat   284 AVLLSIVYFYSSFSRFIMVMGAMLLVYLHQAGWFPFRQEGGQQQAPNNVDANNE-GQNANNLELE 347

  Fly   368 QIQRMMDAAVQRENNDPQAANEPGAVPAAGPAAAGEQDAIDAPPAGAPVAPASAANPEPTDVSAE 432
            :::|:||..::.|:.:.                |||    ||..|..|...|||           
  Rat   348 EMERLMDDGLEDESGED----------------AGE----DASAAQRPGLMASA----------- 381

  Fly   433 AVEPPNANNSVISVVRTFVITFFTSLLPEAP 463
                           .:|:.||||||:||.|
  Rat   382 ---------------WSFITTFFTSLIPEGP 397

Known Domains:


GeneSequenceDomainRegion External IDIdentity
HerpNP_609151.2 Herp_N 28..110 CDD:176385 37/82 (45%)
UBQ 29..110 CDD:214563 37/81 (46%)
Herpud2XP_006242785.1 Herp_N 9..87 CDD:176385 37/82 (45%)
UBQ 10..87 CDD:214563 37/81 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C137903588
eggNOG 1 0.900 E1_KOG4583
Hieranoid 1 1.000
Homologene 1 1.000 H10756
Inparanoid 1 1.050 134 1.000 Inparanoid score I4422
OMA 1 1.010
OrthoDB 1 1.010 D1251727at2759
OrthoFinder 1 1.000 FOG0002266
OrthoInspector 1 1.000 T618833
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 LDO PTHR12943
Phylome 00.000 Not matched by this tool.
TreeFam 1 0.960
1110.960

Return to query results.
Submit another query.