DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ATPsynGL and AT4G26210

DIOPT Version :8

Sequence 1:NP_609142.1 Gene:ATPsynGL / 34054 FlyBaseID:FBgn0031941 Length:107 Species:Drosophila melanogaster
Sequence 2:NP_194351.1 Gene:AT4G26210 / 828727 AraportID:AT4G26210 Length:122 Species:Arabidopsis thaliana

Alignment Length:112 Identity:25/113 (22%)
Similarity:45/113 (40%) Gaps:28/113 (25%)


  Fly     2 SQLIAKAKTLVNKMIVAARPQLDEFWKYAKVELSPPLPADFQKLKQTAES---AKLAS------- 56
            |:.::|..|...|.:      ||:...|.:.      ||..:|..:.::.   .:|||       
plant    16 SKFVSKHGTTYYKQL------LDKNKMYIQE------PATIEKCNELSKQLLYTRLASIPGRSES 68

  Fly    57 ----KKDMKGQLKKSGLSQVTVAEAWLNVLVTVEVITWFYMGEVIGR 99
                ...:||..|..  :.:.|.:|.:..|..:|...|:..||::||
plant    69 FWKEVNHVKGLWKNR--ADLKVEDAGIAALFGLECFAWYCAGEIVGR 113

Known Domains:


GeneSequenceDomainRegion External IDIdentity
ATPsynGLNP_609142.1 ATP-synt_G 12..106 CDD:282561 22/103 (21%)
AT4G26210NP_194351.1 ATP-synt_G 21..121 CDD:282561 24/108 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1461139at2759
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR12386
Phylome 00.000 Not matched by this tool.
22.110

Return to query results.
Submit another query.