DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ATPsynGL and atp5l

DIOPT Version :9

Sequence 1:NP_609142.1 Gene:ATPsynGL / 34054 FlyBaseID:FBgn0031941 Length:107 Species:Drosophila melanogaster
Sequence 2:NP_956051.1 Gene:atp5l / 326977 ZFINID:ZDB-GENE-030131-5177 Length:103 Species:Danio rerio


Alignment Length:107 Identity:43/107 - (40%)
Similarity:63/107 - (58%) Gaps:8/107 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSQLIAKAKTLVNKMIVAARPQLDEFWKYAKVELSPPLPADFQKLKQTAESAKLASKKDMKGQLK 65
            :.:|:||..|||...:..::|:|..||.||:|||.||.||:..|        .::..:||....:
Zfish     5 VQKLVAKVPTLVGAAVNYSKPRLATFWYYARVELVPPTPAEIPK--------AISGFQDMLKAFQ 61

  Fly    66 KSGLSQVTVAEAWLNVLVTVEVITWFYMGEVIGRRHLVGYKV 107
            ...:.|.||.:|..|.||..||:.|||:||:||:|.|:||.|
Zfish    62 SGRVGQTTVRDAVRNGLVATEVLMWFYIGEIIGKRGLIGYDV 103

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ATPsynGLNP_609142.1 ATP-synt_G 12..106 CDD:282561 36/93 (39%)
atp5lNP_956051.1 ATP-synt_G 16..102 CDD:282561 36/93 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170596446
Domainoid 1 1.000 86 1.000 Domainoid score I8063
eggNOG 1 0.900 - - E1_KOG4103
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 89 1.000 Inparanoid score I5107
OMA 1 1.010 - - QHG52212
OrthoDB 1 1.010 - - D1461139at2759
OrthoFinder 1 1.000 - - FOG0003653
OrthoInspector 1 1.000 - - otm26629
orthoMCL 1 0.900 - - OOG6_104623
Panther 1 1.100 - - O PTHR12386
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2416
SonicParanoid 1 1.000 - - X3021
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1514.800

Return to query results.
Submit another query.