powered by:
                  
 
    
 
    
             
          
            Protein Alignment ATPsynGL and atp5l
  DIOPT Version :9 
      
        
          
            | Sequence 1: | NP_609142.1 | 
            Gene: | ATPsynGL / 34054 | 
            FlyBaseID: | FBgn0031941 | 
            Length: | 107 | 
            Species: | Drosophila melanogaster | 
          
          
            | Sequence 2: | NP_956051.1 | 
            Gene: | atp5l / 326977 | 
            ZFINID: | ZDB-GENE-030131-5177 | 
            Length: | 103 | 
            Species: | Danio rerio | 
          
        
        
        
          
            | Alignment Length: | 107 | 
            Identity: | 43/107 - (40%) | 
          
          
            | Similarity: | 63/107 -  (58%) | 
            Gaps: | 8/107 - (7%) | 
          
        
      
- Green bases have known domain annotations that are detailed below.
      | 
 
  Fly     1 MSQLIAKAKTLVNKMIVAARPQLDEFWKYAKVELSPPLPADFQKLKQTAESAKLASKKDMKGQLK 65 
            :.:|:||..|||...:..::|:|..||.||:|||.||.||:..|        .::..:||....: 
Zfish     5 VQKLVAKVPTLVGAAVNYSKPRLATFWYYARVELVPPTPAEIPK--------AISGFQDMLKAFQ 61 
 
  Fly    66 KSGLSQVTVAEAWLNVLVTVEVITWFYMGEVIGRRHLVGYKV 107 
            ...:.|.||.:|..|.||..||:.|||:||:||:|.|:||.| 
Zfish    62 SGRVGQTTVRDAVRNGLVATEVLMWFYIGEIIGKRGLIGYDV 103 
 
       | 
      
        Known Domains:
         Indicated by green bases in alignment.
        
      
      
      
        Information from Original Tools:
        
        
          
            | Tool | 
            Simple Score | 
            Weighted Score | 
            Original Tool Information | 
          
          
            | BLAST Result | 
            Score | 
            Score Type | 
            Cluster ID | 
          
          
          
            | Compara | 
            1 | 
            0.930 | 
            - | 
            - | 
             | 
            C170596446 | 
          
          
            | Domainoid | 
            1 | 
            1.000 | 
            86 | 
            1.000 | 
            Domainoid score | 
            I8063 | 
          
          
            | eggNOG | 
            1 | 
            0.900 | 
            - | 
            - | 
             | 
            E1_KOG4103 | 
          
          
            | Hieranoid | 
            1 | 
            1.000 | 
            - | 
            - | 
             | 
             | 
          
          
            | Homologene | 
            0 | 0.000 | 
            
              Not matched by this tool. | 
          
          
            | Inparanoid | 
            1 | 
            1.050 | 
            89 | 
            1.000 | 
            Inparanoid score | 
            I5107 | 
          
          
            | OMA | 
            1 | 
            1.010 | 
            - | 
            - | 
             | 
            QHG52212 | 
          
          
            | OrthoDB | 
            1 | 
            1.010 | 
            - | 
            - | 
             | 
            D1461139at2759 | 
          
          
            | OrthoFinder | 
            1 | 
            1.000 | 
            - | 
            - | 
             | 
            FOG0003653 | 
          
          
            | OrthoInspector | 
            1 | 
            1.000 | 
            - | 
            - | 
             | 
            otm26629 | 
          
          
            | orthoMCL | 
            1 | 
            0.900 | 
            - | 
            - | 
             | 
            OOG6_104623 | 
          
          
            | Panther | 
            1 | 
            1.100 | 
            - | 
            - | 
            O | 
            PTHR12386 | 
          
          
            | Phylome | 
            1 | 
            0.910 | 
            - | 
            - | 
             | 
             | 
          
          
            | RoundUp | 
            1 | 
            1.030 | 
            - | 
            avgDist | 
            Average_Evolutionary_Distance | 
            R2416 | 
          
          
            | SonicParanoid | 
            1 | 
            1.000 | 
            - | 
            - | 
             | 
            X3021 | 
          
          
            | SwiftOrtho | 
            0 | 0.000 | 
            
              Not matched by this tool. | 
          
          
            | TreeFam | 
            1 | 
            0.960 | 
            - | 
            - | 
             | 
             | 
          
          
            | ZFIN | 
            0 | 0.000 | 
            
              Not matched by this tool. | 
          
          
             | 
            15 | 14.800 | 
             | 
          
        
      
           
             Return to query results.
             Submit another query.