DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ATPsynGL and atp5l

DIOPT Version :8

Sequence 1:NP_609142.1 Gene:ATPsynGL / 34054 FlyBaseID:FBgn0031941 Length:107 Species:Drosophila melanogaster
Sequence 2:NP_956051.1 Gene:atp5l / 326977 ZFINID:ZDB-GENE-030131-5177 Length:103 Species:Danio rerio

Alignment Length:107 Identity:43/108 (40%)
Similarity:63/108 (58%) Gaps:8/108 (7%)


  Fly     1 MSQLIAKAKTLVNKMIVAARPQLDEFWKYAKVELSPPLPADFQKLKQTAESAKLASKKDMKGQLK 65
            :.:|:||..|||...:..::|:|..||.||:|||.||.||:..|        .::..:||....:
Zfish     5 VQKLVAKVPTLVGAAVNYSKPRLATFWYYARVELVPPTPAEIPK--------AISGFQDMLKAFQ 61

  Fly    66 KSGLSQVTVAEAWLNVLVTVEVITWFYMGEVIGRRHLVGYKV 107
            ...:.|.||.:|..|.||..||:.|||:||:||:|.|:||.|
Zfish    62 SGRVGQTTVRDAVRNGLVATEVLMWFYIGEIIGKRGLIGYDV 103

Known Domains:


GeneSequenceDomainRegion External IDIdentity
ATPsynGLNP_609142.1 ATP-synt_G 12..106 CDD:282561 37/94 (39%)
atp5lNP_956051.1 ATP-synt_G 16..102 CDD:282561 37/94 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C239826154
eggNOG 1 0.900 E1_KOG4103
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 89 1.000 Inparanoid score I5031
OMA 1 1.010
OrthoDB 1 1.010 D1461139at2759
OrthoFinder 1 1.000 FOG0003353
OrthoInspector 1 1.000 T597546
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR12386
Phylome 1 0.910 0.800 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R2416
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
1211.900

Return to query results.
Submit another query.