DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ATPsynGL and Atp5l

DIOPT Version :8

Sequence 1:NP_609142.1 Gene:ATPsynGL / 34054 FlyBaseID:FBgn0031941 Length:107 Species:Drosophila melanogaster
Sequence 2:NP_038823.2 Gene:Atp5l / 27425 MGIID:1351597 Length:103 Species:Mus musculus

Alignment Length:105 Identity:46/106 (43%)
Similarity:61/106 (58%) Gaps:16/106 (15%)


  Fly     7 KAKTLVNKMIVAARPQLDEFWKYAKVELSPPLPAD----FQKLKQTAESAKLASKKDMKGQLKKS 67
            ||.::|...:..::|:|..||.||||||.||.||:    .|.:|:..:|||..|.|         
Mouse    11 KAPSMVAAAVTYSKPRLATFWHYAKVELVPPTPAEIPTAIQSVKKIIQSAKTGSFK--------- 66

  Fly    68 GLSQVTVAEAWLNVLVTVEVITWFYMGEVIGRRHLVGYKV 107
               .:||.||.||.||..||..|||:||:||:|.:|||.|
Mouse    67 ---HLTVKEAVLNGLVATEVWMWFYIGEIIGKRGIVGYDV 103

Known Domains:


GeneSequenceDomainRegion External IDIdentity
ATPsynGLNP_609142.1 ATP-synt_G 12..106 CDD:282561 43/98 (44%)
Atp5lNP_038823.2 ATP-synt_G 16..102 CDD:309729 43/98 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C239815611
eggNOG 1 0.900 E1_KOG4103
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0003353
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR12386
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
65.900

Return to query results.
Submit another query.