DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ATPsynGL and ATP5MGL

DIOPT Version :8

Sequence 1:NP_609142.1 Gene:ATPsynGL / 34054 FlyBaseID:FBgn0031941 Length:107 Species:Drosophila melanogaster
Sequence 2:NP_001159349.1 Gene:ATP5MGL / 267020 HGNCID:13213 Length:100 Species:Homo sapiens

Alignment Length:105 Identity:43/105 - (40%)
Similarity:56/105 - (53%) Gaps:16/105 - (15%)


  Fly     4 LIAKAKTLVNKMIVAARPQLDEFWKYAKVELSPPLPAD----FQKLKQTAESAKLASKKDMKGQL 64
            |:.|...|||..:...:|:|..||.|..|||.||.||:    .|.||:...||:..|.|      
Human     8 LVEKTPALVNAAVTYLKPRLAAFWYYTTVELVPPTPAEIPRAIQSLKKIVSSAQTGSFK------ 66

  Fly    65 KKSGLSQVTVAEAWLNVLVTVEVITWFYMGEVIGRRHLVG 104
                  |:||.||.||.||..||.||||:.|:.|:|.::|
Human    67 ------QLTVKEALLNGLVATEVSTWFYVREITGKRGIIG 100

Known Domains:


GeneSequenceDomainRegion External IDIdentity
ATPsynGLNP_609142.1 ATP-synt_G 12..106 CDD:282561 40/97 (41%)
ATP5MGLNP_001159349.1 ATP-synt_G 16..100 CDD:309729 39/95 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C239831001
eggNOG 1 0.900 E1_KOG4103
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D1461139at2759
OrthoFinder 1 1.000 FOG0003353
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR12386
Phylome 1 0.910 0.800 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
98.820

Return to query results.
Submit another query.