DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ATPsynGL and asg-2

DIOPT Version :8

Sequence 1:NP_609142.1 Gene:ATPsynGL / 34054 FlyBaseID:FBgn0031941 Length:107 Species:Drosophila melanogaster
Sequence 2:NP_509152.1 Gene:asg-2 / 180956 WormBaseID:WBGene00000210 Length:131 Species:Caenorhabditis elegans

Alignment Length:77 Identity:29/77 - (37%)
Similarity:47/77 - (61%) Gaps:8/77 - (10%)


  Fly    31 KVELSPPLPADFQKLKQTAESAKLASKKDMKGQLKKSGLSQVTVAEAWLNVLVTVEVITWFYMGE 95
            |.||:||..||:..:|  |:.||:.|      .::..|...:::.|..:...||:||:.||::||
 Worm    39 KHELAPPRQADWPAIK--ADWAKVQS------FIQTGGYKNLSIREGLVYTAVTLEVVFWFFVGE 95

  Fly    96 VIGRRHLVGYKV 107
            :||||::.||.|
 Worm    96 MIGRRYIFGYLV 107

Known Domains:


GeneSequenceDomainRegion External IDIdentity
ATPsynGLNP_609142.1 ATP-synt_G 12..106 CDD:282561 27/74 (36%)
asg-2NP_509152.1 ATP-synt_G 20..105 CDD:282561 26/73 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C238826367
eggNOG 1 0.900 E1_KOG4103
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 75 1.000 Inparanoid score I3820
Isobase 1 0.950 0 Normalized mean entropy S3876
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1461139at2759
OrthoFinder 1 1.000 FOG0003353
OrthoInspector 1 1.000 T98064
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR12386
Phylome 1 0.910 0.800 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R2416
TreeFam 00.000 Not matched by this tool.
1110.880

Return to query results.
Submit another query.