DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ATPsynGL and asg-1

DIOPT Version :8

Sequence 1:NP_609142.1 Gene:ATPsynGL / 34054 FlyBaseID:FBgn0031941 Length:107 Species:Drosophila melanogaster
Sequence 2:NP_492352.1 Gene:asg-1 / 172673 WormBaseID:WBGene00000209 Length:131 Species:Caenorhabditis elegans

Alignment Length:104 Identity:33/105 (31%)
Similarity:52/105 (50%) Gaps:15/105 (14%)


  Fly    11 LVNKMIVAARPQLDEFWK-------YAKVELSPPLPADFQKLKQTAESAKLASKKDMKGQLKKSG 68
            |.|......|.|..:|.:       ..|.||:||..||...:|  |:.|||....:.|..:    
 Worm    12 LANTFGALYRHQAQQFPRRLAILKAVGKHELAPPRSADIPAIK--ADWAKLQKFIETKQYV---- 70

  Fly    69 LSQVTVAEAWLNVLVTVEVITWFYMGEVIGRRHLVGYKV 107
              .:::.|:.:...|.:||:.||::||:||||::.||.|
 Worm    71 --NLSIKESLVYSAVALEVVFWFFVGEMIGRRYIFGYIV 107

Known Domains:


GeneSequenceDomainRegion External IDIdentity
ATPsynGLNP_609142.1 ATP-synt_G 12..106 CDD:282561 31/101 (31%)
asg-1NP_492352.1 ATP-synt_G 20..105 CDD:282561 29/93 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C238826382
eggNOG 1 0.900 E1_KOG4103
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 75 1.000 Inparanoid score I3820
Isobase 1 0.950 0 Normalized mean entropy S3876
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1461139at2759
OrthoFinder 1 1.000 FOG0003353
OrthoInspector 1 1.000 T98064
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR12386
Phylome 1 0.910 0.800 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R2416
TreeFam 00.000 Not matched by this tool.
1110.880

Return to query results.
Submit another query.