DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ATPsynGL and ATP5MG

DIOPT Version :9

Sequence 1:NP_609142.1 Gene:ATPsynGL / 34054 FlyBaseID:FBgn0031941 Length:107 Species:Drosophila melanogaster
Sequence 2:NP_006467.4 Gene:ATP5MG / 10632 HGNCID:14247 Length:103 Species:Homo sapiens


Alignment Length:108 Identity:48/108 - (44%)
Similarity:63/108 - (58%) Gaps:16/108 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LIAKAKTLVNKMIVAARPQLDEFWKYAKVELSPPLPAD----FQKLKQTAESAKLASKKDMKGQL 64
            |:.|...|||..:..::|:|..||.||||||.||.||:    .|.||:...||:..|.|      
Human     8 LVEKTPALVNAAVTYSKPRLATFWYYAKVELVPPTPAEIPRAIQSLKKIVNSAQTGSFK------ 66

  Fly    65 KKSGLSQVTVAEAWLNVLVTVEVITWFYMGEVIGRRHLVGYKV 107
                  |:||.||.||.||..||:.|||:||:||:|.::||.|
Human    67 ------QLTVKEAVLNGLVATEVLMWFYVGEIIGKRGIIGYDV 103

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ATPsynGLNP_609142.1 ATP-synt_G 12..106 CDD:282561 43/97 (44%)
ATP5MGNP_006467.4 ATP-synt_G 10..101 CDD:398409 44/102 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165160123
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4103
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S3876
OMA 1 1.010 - - QHG52212
OrthoDB 1 1.010 - - D1461139at2759
OrthoFinder 1 1.000 - - FOG0003653
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_104623
Panther 1 1.100 - - O PTHR12386
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2416
SonicParanoid 1 1.000 - - X3021
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1312.700

Return to query results.
Submit another query.