DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ATPsynGL and ATP5MG

DIOPT Version :8

Sequence 1:NP_609142.1 Gene:ATPsynGL / 34054 FlyBaseID:FBgn0031941 Length:107 Species:Drosophila melanogaster
Sequence 2:NP_006467.4 Gene:ATP5MG / 10632 HGNCID:14247 Length:103 Species:Homo sapiens

Alignment Length:108 Identity:48/109 (44%)
Similarity:63/109 (58%) Gaps:16/109 (15%)


  Fly     4 LIAKAKTLVNKMIVAARPQLDEFWKYAKVELSPPLPAD----FQKLKQTAESAKLASKKDMKGQL 64
            |:.|...|||..:..::|:|..||.||||||.||.||:    .|.||:...||:..|.|      
Human     8 LVEKTPALVNAAVTYSKPRLATFWYYAKVELVPPTPAEIPRAIQSLKKIVNSAQTGSFK------ 66

  Fly    65 KKSGLSQVTVAEAWLNVLVTVEVITWFYMGEVIGRRHLVGYKV 107
                  |:||.||.||.||..||:.|||:||:||:|.::||.|
Human    67 ------QLTVKEAVLNGLVATEVLMWFYVGEIIGKRGIIGYDV 103

Known Domains:


GeneSequenceDomainRegion External IDIdentity
ATPsynGLNP_609142.1 ATP-synt_G 12..106 CDD:282561 44/98 (45%)
ATP5MGNP_006467.4 ATP-synt_G 16..102 CDD:309729 44/98 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C239820857
eggNOG 1 0.900 E1_KOG4103
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 0 Normalized mean entropy S3876
OMA 1 1.010
OrthoDB 1 1.010 D1461139at2759
OrthoFinder 1 1.000 FOG0003353
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR12386
Phylome 1 0.910 0.800 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R2416
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
1110.800

Return to query results.
Submit another query.