DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Acp1 and CG7203

Sequence 1:NP_477115.1 Gene:Acp1 FlyBaseID:FBgn0014454 Length:135 Species:Drosophila melanogaster
Sequence 2:NP_001285713.1 Gene:CG7203 FlyBaseID:FBgn0031942 Length:129 Species:Drosophila melanogaster

Alignment Length:137 Identity:75/138 (54%)
Similarity:90/138 (65%) Gaps:12/138 (9%)


  Fly     1 MKFAVAVIFTLALAMGVQSSVIPLLSQVAGHGLSYTAVSGPAVVASPWAVPAAHWPAAVNVASWP 65
            |||||.|:. .|||.||.|||:|||:  :.|||   .|..|||..|. |:.|:..||||.::..|
  Fly     1 MKFAVVVVL-FALAWGVNSSVVPLLT--SAHGL---VVGSPAVAGSV-AIQASAVPAAVPLSLSP 58

  Fly    66 --PAAIHAAAPAVLAAPAP-AVVAAHAPSVVVAPVAHSGVYTAQTRGAIHTAPLAGHIQSVASIN 127
              |..|. :.|||:|||.| ||||||||: |||..|....|.|:||||:|.|||.||:||.||:|
  Fly    59 AGPVLIQ-SGPAVVAAPVPAAVVAAHAPA-VVAVAAPEASYVAKTRGAVHVAPLPGHVQSAASVN 121

  Fly   128 AAPAPGT 134
            ..|||||
  Fly   122 LEPAPGT 128

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Acp1NP_477115.1 Cuticle_4 55..134 CDD:292577 47/82 (57%)
CG7203NP_001285713.1 Cuticle_4 48..128 CDD:292577 47/82 (57%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C131180267
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR12336
RoundUp 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.