DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Acp1 and CG13795

DIOPT Version :10

Sequence 1:NP_477115.1 Gene:Acp1 / 34052 FlyBaseID:FBgn0014454 Length:135 Species:Drosophila melanogaster
Sequence 2:NP_609138.3 Gene:CG13795 / 34049 FlyBaseID:FBgn0031937 Length:594 Species:Drosophila melanogaster


Alignment Length:33 Identity:8/33 - (24%)
Similarity:20/33 - (60%) Gaps:5/33 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 FAVAVIFTLALAMGVQSSVIPLLSQVAGHGLSY 35
            ::..|:|.:::.:    .|:|:|: :.|:|..|
  Fly   514 YSTTVVFVMSIVL----VVLPILA-IPGYGFYY 541

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Acp1NP_477115.1 Cuticle_4 55..134 CDD:464954
CG13795NP_609138.3 SLC5-6-like_sbd 27..505 CDD:271356
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.