DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Tep3 and Tep2

Sequence 1:NP_523507.2 Gene:Tep3 FlyBaseID:FBgn0041181 Length:1469 Species:Drosophila melanogaster
Sequence 2:NP_523506.1 Gene:Tep2 FlyBaseID:FBgn0041182 Length:1420 Species:Drosophila melanogaster

Alignment Length:1464 Identity:523/1465 (36%)
Similarity:819/1465 (56%) Gaps:106/1465 (7%)


  Fly    14 LILVTACLLCQTSAQGLYSIIAPNTLRPNSQFHVAVSLHNAPESATFKVGILGSSYTDFKTVELR 78
            :||..|.|:   :|.|:||::.|.|||.||:::|.||:|.|...:..||.:.|.||.:.|.:||.
  Fly     9 IILQYALLV---NATGIYSVVGPGTLRSNSKYNVVVSVHKADGPSQIKVSLNGPSYNETKQIELP 70

  Fly    79 PFSTQLLHFEIPALRTDRYRLTAEGLGGVQFTNETQLHFESKQHTVLVQTDKSIYKPGDLVHYRV 143
            |.|||.:.||:|.|.|..|.|:|||:.||.|.|.|:|::..|:.:|.|||||:.|||.|||.:|:
  Fly    71 PMSTQNVEFEVPKLATGNYNLSAEGVSGVVFKNSTKLNYADKKPSVFVQTDKATYKPADLVQFRI 135

  Fly   144 LILDANLKPARGYGRVHVDIKDSGDNIIRSYKDIRLTNSIYSNELRLSDSPRFGTWSIVVDV-SD 207
            |.||.|.:||:....:.|.|.|...|.|:...|::||..::|.||:||:.|..|||.|.|.| .|
  Fly   136 LFLDENTRPAKIEKPISVIIIDGAQNRIKQLSDVKLTKGVFSGELQLSEQPVLGTWKISVSVDGD 200

  Fly   208 QEHTQTFEILDHILPKFVVDIDTPKHAIYKDGKIAATVRAHYAFGQPIVGEATLSIYPT--FFGS 270
            ...|::||:..::||||.|.:||||..:..|..|.||:||.|.:|:|:.|:||:|:..:  :||.
  Fly   201 NRETKSFEVDKYVLPKFEVIVDTPKAVVIADKVIKATIRAKYTYGKPVKGKATVSMERSYGYFGD 265

  Fly   271 LQPFVNDLITRKVVPIDGNAYFEFDIENELHLKQDYERQYL----LDALVEEKSTGSVQNYSTVL 331
            |.  .|.....|.:.:||..:.||||   :|..|  ..|||    |.|:|.|:.||:.||.:..:
  Fly   266 LN--ANGNKQEKTIDVDGKGHVEFDI---IHWAQ--RGQYLPPIKLFAVVTEELTGNKQNATATV 323

  Fly   332 TLHLNHYRVEAVKVPSYYIPGVPFEATARIARNDGGQLRDFNPQITAYLTNV-YGSSEMYNRTAY 395
            .||...|.:|..:.|.::.....|.....:...||.       .:|....|| .|..:.|   :|
  Fly   324 VLHQQRYSIEPYERPEHFEANKSFIYQVVVKNVDGS-------PVTNSAKNVKIGFDKSY---SY 378

  Fly   396 SLDASGEIKMKFTVPIGDR-------------DEFHSIIVDYQGVISEVGKI----PSKHLHSKN 443
            ..:.|.:.::.|..|:.:.             ..::.|...:.|..:.:|.|    |:.  .|:.
  Fly   379 FHEPSPKTRINFEAPVNENGIATFNVRLPDSDSRYYRIFASFDGSENTIGSISKFEPTP--MSRE 441

  Fly   444 YITAKVLNDRPTVNQEISVVVRSFAPIKYFMYQVVGRGDIILSRNVDVAPG-TFHTIKFLASFAM 507
            .:..:|...:|.:.:::|..|.|...:.||:|.:|.||::|||..|||..| ..:|:||..:|:|
  Fly   442 PLKIQVNTKKPRLGEQVSFDVVSIEDLPYFVYTIVARGNVILSDYVDVPDGQKTYTVKFTPTFSM 506

  Fly   508 MPRANLLVYTVIDGEFVYDEQVIQLEENLLNAVQVDAPIRAPPGQDIDIGISTKPYSYVGLMLVD 572
            :|:|.:.||.|::.:..::|:.|..|:...|::.|.||..|.|.:::.:.|.|...|:|||:.||
  Fly   507 VPKATIYVYYVVNNDLQFEEKTIDFEKEFSNSIDVSAPTNAKPSEEVKLRIKTDADSFVGLLGVD 571

  Fly   573 QNANDLRSGHDLTHKRLMDALRSYELSDVNTPMGS-----PGKESGVITMSNTDYFIEKEAESNP 632
            |:...|:||:||:...:.::|..|:.|   ||..:     ||:.||::|::|.:|    ...:.|
  Fly   572 QSVLLLKSGNDLSQDDIFNSLNIYQTS---TPWMNGYGRYPGQTSGLVTLTNANY----PYNTGP 629

  Fly   633 ALDREVSTGPEEDKLTTVRKTDIGPAHKIEVNTLPPGKG----RYAF---------------SYT 678
            .:...|..|.....:|.       |.:::.:      :|    |.:|               ..|
  Fly   630 LVMSYVFEGSRHPWITR-------PRYRVGI------RGDSGDRISFLSQSLNDRNLKEILLKQT 681

  Fly   679 PKPFWHNPRVHVMRDPADTWLFLNISASSDGRNSIHRRIPSEMTSWVVSAFALDPVNGLGLSPPN 743
            |:      |..:.::..:||.|.|:   .:...::.::||..:|||||:.|:|:|.:|:.|:...
  Fly   682 PQ------RTTIRKEFPETWFFENV---GEEEFTLTKKIPDTITSWVVTGFSLNPTSGIALTKNP 737

  Fly   744 GKLEAYKEFYISTELPYSIKRDELIAIPFVVHNNRDSDLNVEVTFYNSALDFDFPQLDPKATNQP 808
            .|:..::.|::||.||||:||.|:||||.|:.|..|..|:.:|...||..:::|.:...:...:.
  Fly   738 SKIRVFQPFFVSTNLPYSVKRGEVIAIPVVIFNYLDKTLDADVVMDNSDQEYEFTEATNEVLEKA 802

  Fly   809 KVELYRRRSLQVPGRSARSVSFIVTPKRVGPLLVKAMAASSQAGDTVEQNLLVEHPGAMERINRG 873
            ..|:.|.:.:.:|..|.:||||::.||.||...:|..|.|:.|||.:.|.|.||..|.....||.
  Fly   803 IDEVRRVKRVTIPANSGKSVSFMIRPKNVGFTTLKITATSALAGDAIHQKLKVEPEGVTLFENRA 867

  Fly   874 FLFELNSNAQNRRNVTIAVPRNAIPESTRIEVSAVGDLIGSLVGNLDSLILLPTGCGEQTMVNFV 938
            ....|....:..:::...:|...:|:|..||.|.||||:|..:.|||:|:.:|.|||||.|||||
  Fly   868 VFINLKDQPEMSQSLDADIPNEVVPQSEFIEFSVVGDLLGPTLQNLDNLVRMPYGCGEQNMVNFV 932

  Fly   939 PNLIVLRYLGRLRQLTPEVELRATNNLAIGYQRILYYRHENGAFSAFGLDIKRSSTWLTAYVARS 1003
            ||::||:||....:..|.||.:|...|.|||||.|.|:|::|::||||......||||||||.||
  Fly   933 PNILVLKYLEVTGRKLPSVESKARKFLEIGYQRELTYKHDDGSYSAFGKSDASGSTWLTAYVMRS 997

  Fly  1004 LRQAAPFTQVDSNVLQKALTYLGSVQSANGGFEERGDVFERFGDDGISLTAFVTLALMENVDLYP 1068
            ..||..:|.:|..|:...|.:|.|.|..:|.|.|.|.:|:....:.::||:||.||..||.:|.|
  Fly   998 FHQAGTYTDIDPKVITAGLDFLVSKQKESGEFPEVGKLFDNANQNPLALTSFVLLAFFENHELIP 1062

  Fly  1069 EYRNNINKALDFITRGLDGSSNLHAMAIGTYVLSRANHNAKAAFLQRLDSMATNKDGLKWWNK-T 1132
            :|::.|.||:.::....|.:.:.:::||....|..|.|......:.:|:|:|..::...||:| |
  Fly  1063 KYQSAIKKAVRYVAEEADKTDDQYSLAIAAVALQLAKHPQSEKVIAKLESVARKENDRMWWSKAT 1127

  Fly  1133 APAGEQQSPWYNATRSVNIEISAYAALALLENNLVGDALPVLNWLMDQRNPKGGFVASQDTVVGL 1197
            ...||....::...||.::||::|..|||||.:....|||::.||:.|||..|||.::||||:||
  Fly  1128 ESTGEDGRVFHWKPRSNDVEITSYVLLALLEKDPAEKALPIIKWLISQRNSNGGFSSTQDTVIGL 1192

  Fly  1198 QALLMFAERFSSQGNNLQIGFHYGEGAETIINVNAENSLALQTVELPNNLKNLSVSATGRGMALA 1262
            |||..||.:..|....:.|.|.....::..|.||.||||.|||.:||.:.:.:..:|.|.|.|:.
  Fly  1193 QALTKFAYKTGSGSGTMDIEFSSAGESKNTIKVNPENSLVLQTHDLPKSTRKVDFTAKGTGSAMV 1257

  Fly  1263 QVSYTYNTNVTSAWPRFVLDPTVNRNSHADYLHLSACASFVSVV-GENEQRSNMAVMEVHLPSGF 1326
            |:||.||.......|.|.:.||| :::....|.:..||.:|.:. .:.::.|||||||:.|||||
  Fly  1258 QLSYRYNLAEKEKKPSFKVTPTV-KDTPNQLLIVDVCAEYVPLEDADKDKDSNMAVMEIALPSGF 1321

  Fly  1327 VVDRDTLPTLESSERIKKVETQNRNTKVVIYFDYLDRREV-CPTLHAYKTVKVTKHRPVAVVMYD 1390
            |.|..:|..:::.:|:|:|||:|.::.||:|||.|...:| |..|.|.|...|.|.:|.:|.:||
  Fly  1322 VGDSTSLGKIQAVDRVKRVETKNSDSTVVVYFDSLTPGDVRCLPLEASKAHAVAKQKPASVSLYD 1386

  Fly  1391 YYDSARRARQFYRAPKSNICDICEHANCGDLCEK 1424
            |||:.|:|.::|:. ||::|||||.|:||:.|:|
  Fly  1387 YYDTERKATEYYQV-KSSLCDICEGADCGEGCKK 1419

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Tep3NP_523507.2 A2M_N 124..215 CDD:280081 42/92 (46%)
A2M_N_2 448..573 CDD:285005 45/126 (36%)
A2M 697..787 CDD:278630 36/90 (40%)
A2M_2 918..1203 CDD:239227 122/286 (43%)
A2M_comp 967..1200 CDD:284982 95/234 (41%)
A2M_recep 1313..1402 CDD:284981 43/90 (48%)
Tep2NP_523506.1 A2M_N 115..209 CDD:280081 43/94 (46%)
A2M_N_2 445..576 CDD:285005 46/131 (35%)
A2M 694..782 CDD:278630 36/91 (40%)
A2M_2 909..1198 CDD:239227 122/289 (42%)
A2M_comp 961..1199 CDD:284982 97/238 (41%)
A2M_recep 1308..1398 CDD:284981 43/90 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C339060854
eggNOG 1 0.900 E1_COG2373
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 674 1.000 Inparanoid score I369
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D177369at33208
OrthoFinder 1 1.000 FOG0000048
orthoMCL 1 0.900 OOG5_130297
Panther 1 1.100 P PTHR11412
RoundUp 00.000 Not matched by this tool.
76.890

Return to query results.
Submit another query.