DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Tep2 and si:dkey-46g23.2

Sequence 1:NP_523506.1 Gene:Tep2 FlyBaseID:FBgn0041182 Length:1420 Species:Drosophila melanogaster
Sequence 2:XP_021327775.1 Gene:si:dkey-46g23.2 ZFINID:ZDB-GENE-070705-476 Length:1359 Species:Danio rerio

Alignment Length:1477 Identity:384/1478 (26%)
Similarity:649/1478 (44%) Gaps:276/1478 (19%)


  Fly    75 QNVEFEVPKLATGNYNLSAEGVSGVV----FK--NSTKLNYADKKPSVFVQTDKATYKPADLVQF 133
            :::::::..|.:|:   |.:.|..||    ||  ...|:.:....|..|:||||..|.|...|.|
Zfish     3 EDMKYDLAPLVSGD---SVQTVRVVVQGQSFKMTEERKVMFRSYLPLTFIQTDKPLYNPGQTVNF 64

  Fly   134 RILFLDENTRPAKIEKPISVIIIDGAQN-RIKQLSDVKLTKGVFSGELQLSEQPVLGTWKISVSV 197
            |::.:.:...|  :::..::::::..:| ||.|.::|.....:......|..:..:||:.:...:
Zfish    65 RVVTMSDKLVP--LDQMYNLVVLEDFRNIRINQWTNVSSVNWILELSHVLIPEAQVGTYTLRAYI 127

  Fly   198 DGDNRETKSFEVDKYVLPKFEVIVDTPKAVVIADKVIKATIRAKYTYGKPVKGKATVSMERS-YG 261
             ||...::||:|.:||||||:|.|:.|:...:||..:|.....|||:|:||.|:..|.:.|. :.
Zfish   128 -GDRIISQSFDVKQYVLPKFDVTVNAPQTYSVADVGLKVEACGKYTFGQPVPGQVLVEVCRQPFT 191

  Fly   262 YFGDLNANGNKQEKTIDVDGKGHVEFDI---------IHWAQRGQYLPPIKLFAVVTEELTGNKQ 317
            :..|.........|:...:..|.....:         .....:..::..:.|    |||.||...
Zfish   192 FAQDPKVTSICLIKSTKTNNTGCASLTLSTSSFFGTSFESNLQNSFVVNVNL----TEEGTGVVM 252

  Fly   318 NATATVVLHQQRYSIEPYERPEHFEANKSFIYQVVVKNVDGSPVTNSAKNVKIGFDKSYSYFHEP 382
            :.:.||.:..:...:...:.|:.:....:...::.|.:.:|:|:.:.|           .|..:.
Zfish   253 SKSTTVSITFEVGKVTFVDLPKFYNYGSTVNGKISVSDFNGNPINSKA-----------VYLLDS 306

  Fly   383 S--PKTRINFEAPVNENGIATFNV---RLPDSD---------SRYYRIFASFDGSENTIGSISKF 433
            |  | .::.|....|:||.|.|::   ..|.:|         ..|:...:.:..:::.:..:|:.
Zfish   307 SIWP-NKLLFNLTTNKNGFAKFSLDTTSFPQADLNLVASATPQSYFSSNSPYFTTDSQVVQLSQT 370

  Fly   434 EP-TP--------MSREPLK----IQVNTKKPRLGE--QVSFDVVSIEDLPYFVYTIVARGNVIL 483
            :| ||        ...:|||    ..|..|...:||  ..|.|:         :|.:::||.::|
Zfish   371 DPDTPTFSDLSIVKLEQPLKCGTTYSVTVKYLFVGETGDYSADI---------IYMVMSRGVIVL 426

  Fly   484 SDYVDVPDGQKTYTVKFTPTF------SMVPKATIYVYYVVNNDLQFEEKTI-DFEKEFSNSIDV 541
            ..:..|.........|.|.||      .|.|...|.||.|:.:........: |.||.|:|.:.:
Zfish   427 HGFKTVQARASNTLTKGTVTFDLSILAKMAPVVQILVYSVLPSQTVVTGSALFDTEKCFANQVSL 491

  Fly   542 S-APTNAKPSEEVKLRIKTDADSFVGLLGVDQSVLLLKSGNDLSQDDIFNSLNIYQTSTPWMNGY 605
            . :|.:|.|.|...|.:...|.|..||..:|||||:::||..||.:.:||.|.:...|       
Zfish   492 QFSPASAVPGEGSILTVSAQAGSLCGLSAIDQSVLIMQSGGRLSAEAVFNMLPLQSLS------- 549

  Fly   606 GRYPGQTSGLVTLTNANYPYNTGPLVMSYVFEGSRHPWITRPR--------YR----VGIRGDSG 658
                            :||:..         |..::....|||        |.    |||:    
Zfish   550 ----------------DYPFGA---------EDQQNCLNVRPRRAVPTDQAYNTFKSVGIK---- 585

  Fly   659 DRISFLSQSLNDR-----NLKEILLKQT-----PQR---------------------------TT 686
                 ::.:|..|     ..|::|..:.     |.|                           .|
Zfish   586 -----IATNLPVREPECLKFKDLLYYRNFHGVFPLREVAFAVSGKAPAPLAMAEMAGTGGSSVVT 645

  Fly   687 IRKEFPETWFFE-----NVGEEEFTLTKKIPDTITSWVVTGFSLNPTSGIALTKNPSKIRVFQPF 746
            :|..|||||.::     :.|.....||  :|||||:|....|.|: ::|..|.. |:.:..||||
Zfish   646 LRTYFPETWIWQLSLVGDSGSTSVPLT--VPDTITTWDTEAFCLS-SNGFGLAP-PALLTSFQPF 706

  Fly   747 FVSTNLPYSVKRGEVIAIPVVIFNYLDKTLDADVVMDNSDQEYEFTEATNEVLEKAIDEVRRVKR 811
            |:...||||:.|||...:...:||||.:.:...|..         |.::|..|....|:    ..
Zfish   707 FLELTLPYSIIRGEAFELVATVFNYLLQCIKIQVTP---------TPSSNYTLTPINDQ----SS 758

  Fly   812 VTIPANSGKSVSFMIRPKNVGFTTLKITATSA----LAG------------DAIHQKLKVEPEGV 860
            .|:..|..|::.:.:....:|...:.|:|.::    |.|            |.:.:.|:|..|||
Zfish   759 STLSTNWRKTIKWALTASVIGTVNVTISAEASPSQELCGDQDVTVPSRGRIDIVTRSLRVLAEGV 823

  Fly   861 TLFENRAVFINLKDQPEMSQSLDADIPNEVVPQSEFIEFSVVGDLLGPTLQNLDNLVRMPYGCGE 925
            .....|:..:..|.. .:|:|:...:|..|:..|.....||:||::|..|.||.||::||.||||
Zfish   824 ERTFTRSWLLCPKGS-MLSESVKITLPTNVIQGSASCSVSVIGDIMGRALNNLANLLQMPSGCGE 887

  Fly   926 QNMVNFVPNILVLKYLEVTGRKLPSVESKARKFLEIGYQRELTYKHDDGSYSAFGKSDASGSTWL 990
            |||:...||:.:|:||.||.:..|::...|..:|..|||.:|.|:|.|||:|.||...:  :|||
Zfish   888 QNMIILAPNVYILRYLTVTAQLTPAIRDTATGYLLTGYQGQLNYRHSDGSFSTFGYDPS--NTWL 950

  Fly   991 TAYVMRSFHQAGTYTDIDPKVITAGLDFLVSKQKESGEFPEVGKLFDNANQ----NPLALTSFVL 1051
            ||:|||:|..|.::|.|||.|:....::|:|.|...|.|.:.|.|:.|..:    :.:.:|.:::
Zfish   951 TAFVMRTFGLARSFTYIDPNVLAGAKNWLISTQGSDGCFVQQGTLYHNDMKGGVGDNVTMTGYIV 1015

  Fly  1052 LAFFENHELIPKYQSAIKKAVRYVAEEADKTDDQYSLAIAAVALQLAKHPQSE-KVIAKLESVAR 1115
            .:..|..  :|.....|.||:.::........:.|..|:.|....||....:. ::::.|.:.|.
Zfish  1016 ASLLEIG--VPVTDPVITKALSFLRPLVGNLGNTYVTALLAHTFSLAGETNTRAQLLSSLRNTAI 1078

  Fly  1116 KENDRMWWSKATESTGEDGRVFHWKPRSND---VEITSYVLLALLEKDPAEK-----ALPIIKWL 1172
            .|...:.||:.|               |.|   |||::|||||:|...|...     |..|:.|:
Zfish  1079 SEGTTLHWSQTT---------------SGDTLAVEISAYVLLAVLTVQPVTTANLGYANRIVNWI 1128

  Fly  1173 ISQRNSNGGFSSTQDTVIGLQALTKFAYK--TGSGSGTMDIEFS-SAGESKNTIKVNPENSLVLQ 1234
            ::|:|..||||||||||:.||||..:|.:  |..||.|:.::.| .||:..| ..|.|.|.|:.|
Zfish  1129 VAQQNPYGGFSSTQDTVVALQALALYAAQAFTPGGSSTVTVQSSVPAGDIFN-FAVTPNNRLLYQ 1192

  Fly  1235 THDLPKSTRKVDFTAKGTGSAMVQLSYRYN-----LAEKEKKPSFKVTPTVKDTPNQLLIVDVCA 1294
            .:.|..........|:|:..|.||::..||     :..:......||:...:..|..|::.    
Zfish  1193 RNSLNNFPGTYSVVARGSACASVQVACFYNIPTPVMVARTLSVVAKVSGDCQAAPVNLMLT---- 1253

  Fly  1295 EYVPLEDADKDKDSNMAVMEIALPSGFVGDSTSLGK-------IQAVDRVKRVETKNSDSTVVVY 1352
              ..::...:...:||.:::|.:.|||..|::.||.       :|.||       .|.|. |:||
Zfish  1254 --FTVKYNGRKPTTNMVLVDIKVLSGFTADTSLLGSPPNFAPLVQRVD-------SNGDH-VLVY 1308

  Fly  1353 FDSLTPGDVRCLPLEASKAHAVAKQKPASVSLYDYYDTERKATEYYQ 1399
            ...:..|......::.::..||...|||.:::||||....|....|:
Zfish  1309 LQEVPKGVPVTFSIQLTQTVAVQNLKPAVINIYDYYQRNDKFETTYK 1355

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Tep2NP_523506.1 A2M_N 115..209 CDD:280081 23/95 (24%)
A2M_N_2 445..576 CDD:285005 40/141 (28%)
A2M 694..782 CDD:278630 33/93 (35%)
A2M_2 909..1198 CDD:239227 107/302 (35%)
A2M_comp 961..1199 CDD:284982 83/251 (33%)
A2M_recep 1308..1398 CDD:284981 28/97 (29%)
si:dkey-46g23.2XP_021327775.1 A2M_N 47..138 CDD:307790 23/94 (24%)
A2M_N_2 380..528 CDD:311575 43/157 (27%)
A2M 653..741 CDD:306673 33/92 (36%)
A2M_2 871..1146 CDD:239227 103/294 (35%)
A2M_recep 1265..1354 CDD:311553 28/97 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C119706765
eggNOG 1 0.900 E1_COG2373
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 522 1.000 Inparanoid score I1190
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D177369at33208
OrthoFinder 1 1.000 FOG0000048
OrthoInspector 1 1.000 T128612
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11412
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
76.990

Return to query results.
Submit another query.