DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Tep2 and cd109

Sequence 1:NP_523506.1 Gene:Tep2 FlyBaseID:FBgn0041182 Length:1420 Species:Drosophila melanogaster
Sequence 2:XP_697512.6 Gene:cd109 ZFINID:ZDB-GENE-120215-253 Length:1487 Species:Danio rerio

Alignment Length:1591 Identity:433/1592 (27%)
Similarity:725/1592 (46%) Gaps:309/1592 (19%)


  Fly     2 FRIFLTGIILQYAL-----------LVNATGIYSVVGPGTLRSN--SKYNVVVSVHKADGPSQIK 53
            |.|.:..::.:.|:           |::.:.:.....|.||...  |.|.:.|:.....|.:.:.
Zfish     7 FGILVCSLVCRGAMVTSSARQNLSYLISVSEVLRCGVPTTLSVTVLSDYPINVTARLTHGKTSVA 71

  Fly    54 VSLNGPSYNETKQIELPPMSTQNVEFEVPKLATGNYNLSAEGVSG--VVFKNSTKLNYADKKPSV 116
            .:.:......::.:.|||:...::.:..|      |.|:.||.||  :||.|||.:.::.:..|:
Zfish    72 QTQSTVPAGSSRLLSLPPVFYDDMTYWYP------YQLNVEGFSGTHLVFSNSTSMVFSPRCMSI 130

  Fly   117 FVQTDKATYKPADLVQFRILFLDENTRPAKIEKPISVIIIDGAQNRIKQLSDVKLTKGVFSGELQ 181
            |:||||..|:|...|:||::.:..:.:|  ......:.|.|...|.|:|...|....||.|.||.
Zfish   131 FIQTDKNYYQPGQTVKFRVVSVTPDGKP--YSGRTDIFIRDPRGNMIRQWLAVDSFLGVISKELN 193

  Fly   182 LSEQPVLGTWKISVSVDGDNRETKSFEVDKYVLPKFEVIVDTPKAVVIADKVIKATIRAKYTYGK 246
            :|:.|.||:|||:..|: |....::|.||.||||:|||.:|.| :|:..:..:..|:.|||.|||
Zfish   194 ISQNPPLGSWKITAGVN-DVIHERAFTVDYYVLPRFEVKLDVP-SVLYCEDTLMGTVTAKYFYGK 256

  Fly   247 PVKGKATVSMERSYGYFGDLNANGNKQEKTIDVDGKGHVEFDIIHWAQR-GQY-------LPPIK 303
            ||.|...|.....:      |....:.:.|..::|...:.||:..::.| ..|       ..||:
Zfish   257 PVSGFMDVRFVHGF------NGIEMRYDHTEMIEGSAEITFDMKDFSTRFNDYSYSYYDGYRPIE 315

  Fly   304 LFAV---VTEELTGNKQNATATVVLHQQRYSIE----PY------------------ERPEHFEA 343
            ...|   :||..||...|::|.|.:..::|.:|    |:                  :||...|.
Zfish   316 FIDVNVNITESATGLMYNSSARVSIVTEKYKLEFLQYPHIVKPSMTFTAKLKLSLYDQRPLSAED 380

  Fly   344 NKSFIYQVVVK-------------------------------NVDGSPVTNSAKNVKIGFDKSYS 377
            ....:|..|.:                               |.||.|:.....|..        
Zfish   381 QIESVYLAVTQHKLSPWTWMWSDGGPLGPRMMNNTPSTSFPPNSDGGPLGPHMMNST-------- 437

  Fly   378 YFHEPSPKTRI------NFEAPVNENGIATFNVRLPDS------DSRY---------YRIFASFD 421
               .|:..|.|      |.|.||..:|:.:|.:.|.||      ::|:         ||.::|  
Zfish   438 ---PPTSFTPIYDLPVQNIELPVTADGLMSFQIHLSDSVATLDLEARFKDTVQHLQLYRSYSS-- 497

  Fly   422 GSENTIGSISKFEPTPMSREPLK--IQVN-TKKPRLGEQVSFDVVSIEDLPYFVYTIVARGNVIL 483
                                |.|  ||:: ..:|::|..::|.:.|..:|....|.:.:|..|:.
Zfish   498 --------------------PSKSYIQLHRDSEPQVGRSLNFTLESSFNLTKIHYLVTSRAGVVD 542

  Fly   484 SDYVDVPDGQKTYTVKFTPTFSM------VPKATIYVYY------VVNNDLQFEEKTIDFEKEFS 536
            :..|.            :.:||:      .|:|.:.|||      :||:.|.     :.|.|...
Zfish   543 AGTVQ------------SSSFSLNTDHLWAPQACVMVYYTLPDGEIVNDALH-----VSFTKVLR 590

  Fly   537 NSIDVS-APTNAKPSEEVKLRIK-TDADSFVGLLGVDQSVLLLKSGNDLSQDDIFNSLNIYQTST 599
            |::.|. :...|:|:|.|.|.:. ::..|.:|:|.||::.|.....|.||:..:......|....
Zfish   591 NTVSVRWSQDRAEPAESVSLSVSVSEPGSVLGILVVDKATLNSAEDNGLSEKTVLEEFLSYSREM 655

  Fly   600 PWMNGYGRYPGQ------TSGLVTLTNA--NYPYNTGPLVMSYVFEGSRHPWITRPRYRVGIRGD 656
            ...:..|...|.      ..|:..||:|  |....|.. .|..:|.|....::|           
Zfish   656 THTDNRGMKMGDPYSVFTACGVTVLTDARLNQEMATNQ-EMFPMFPGEEGLFMT----------- 708

  Fly   657 SGDRISFLSQSLNDRNLKEILLKQTPQRTTIRKEFPETWFF--ENVGEEE---FTLTKKIPDTIT 716
                      ::.|.:::|      |::   ||:|||||.:  .||.:..   |:||  :||::|
Zfish   709 ----------AMPDSSIQE------PRQ---RKDFPETWIWLDANVSDSASAVFSLT--VPDSLT 752

  Fly   717 SWVVTGFSLNPTSGIALTKNPSKIRVFQPFFVSTNLPYSVKRGEVIAIPVVIFNYLDKTLDADVV 781
            ||......::...|:.::. |:::.||:.||:|.:||..:.|||::.:.|.:|||:|..|:..||
Zfish   753 SWAAFAIIMSENLGLGISA-PAELTVFRDFFMSLDLPAFLIRGELLLLEVNLFNYMDVDLEVIVV 816

  Fly   782 MDNSDQEYEFTEATNEVLEKAIDEVRRVKRVTIPANSGKSVSFMIRPKNVGFTTLKITATSALAG 846
            :..|.. :||...     :.|...|..|::|.:.:.:...:.|.|:...:|...:.:.|||..:.
Zfish   817 VAESGM-FEFVST-----DSADFSVANVRKVLVLSQNFTMLLFPIKATTLGEIPISVKATSVYSS 875

  Fly   847 DAIHQKLKVEPEGVTLFENRAVFIN-LKDQPEMSQSLDADIPNEVVPQSEFIEFSVVGDLLGPTL 910
            |.:::.:.|:|||:.....:.:|:. |..|..:|:.:....|.:|||.|:....|.|||:|||::
Zfish   876 DWLYKTVLVKPEGLQQSFTQTLFLEFLLQQHTLSRKMTFSFPADVVPNSQRASVSAVGDILGPSI 940

  Fly   911 QNLDNLVRMPYGCGEQNMVNFVPNILVLKYLEVTGRKLPSVESKARKFLEIGYQRELTYKHDDGS 975
            .|||:|:.||||||||||::|.||..||:||:.|.:.......||..::...|:|||:|:..|||
Zfish   941 GNLDSLIEMPYGCGEQNMIHFAPNTYVLQYLKSTKQAEEQTRRKAMSYMMEAYERELSYQRVDGS 1005

  Fly   976 YSAFGKSDASGSTWLTAYVMRSFHQAGTYTDIDPKVITAGLDFLVSKQKESGEFPEVGKLFDNAN 1040
            :||||.||.||||||:|:|:|.|.||..:..|:|.|:.....:||:.|:..|.|.|.|::.....
Zfish  1006 FSAFGDSDESGSTWLSAFVLRCFLQARDFISIEPLVMERTAFWLVAHQESDGSFREPGQVIHTEL 1070

  Fly  1041 QNPL----ALTSFVLLAFFENHELIPKYQSAIKKAVRYVAEE-ADKTDDQYSLAIAAVALQLAKH 1100
            |..|    :||::||:|..|:.:....::.::..|:.::... |......|||::.|.||.|||.
Zfish  1071 QGGLDGSVSLTAYVLIALLEDAKYESTHKDSVSLALSFLTSRLAQGISSNYSLSLVAYALSLAKS 1135

  Fly  1101 PQSEKVIAKLESVARKENDRMWWSKATESTGEDGRVFH--WKPRSNDVEITSYVLLALLEKDPAE 1163
            ..:...:..|.:.|...:....|.       ..|.|.:  |:|||.|:||.:||||.:......:
Zfish  1136 SAAPSALTTLLNRALVIDGVPTWR-------SPGSVLYDSWQPRSADIEIAAYVLLTMHSLRLMD 1193

  Fly  1164 KALPIIKWLISQRNSNGGFSSTQDTVIGLQALTKFAYKTGSGSGTMD--IEFSSAGESKNTIKVN 1226
            :...::|||..|||..||:.||||||:.|.||:  .|.|.|.:.:||  |..:....:..|..::
Zfish  1194 EGFALMKWLSQQRNHLGGYGSTQDTVMALHALS--VYATFSSAESMDLTIRVNEGSGTVATFSID 1256

  Fly  1227 PENSLVLQTHDLP---KSTRKVDFTAKGTGSAMVQLSYRYNLAEKEKKPSFKVTPTVKDTPNQLL 1288
            ..|.|:.|:||||   |....::..|:|||.|:.||:..||               |.:....|.
Zfish  1257 KSNYLLQQSHDLPIESKDGVDIEVEAEGTGFALFQLTVFYN---------------VMNVRRSLR 1306

  Fly  1289 IVDVCAE---YVPLEDADKDK------------------DSNMAVMEIALPSGFVGDSTSLGKIQ 1332
            ..|:..:   |:.::..||::                  .:.||::::.|.:||   |.:...:|
Zfish  1307 RRDIHTDEAFYLYVDIMDKEEYHVNLYTCFRLRGGQGLNQTGMAILDVGLLTGF---SLAQDGVQ 1368

  Fly  1333 AVDRVKRVETKNSDSTVVVYFDSLTPGDVRCLPLEASKAHAVAKQKPASVSLYDYYDTERKATEY 1397
            ..|.|:||||.:  ..|::|.|.:|..: :|:.:.......||..:.|.:.:||||:..|:....
Zfish  1369 IDDTVRRVETPS--GRVILYLDKVTTVE-QCIEISTVMDFKVAGVQDAVIMIYDYYEPRRRTVRS 1430

  Fly  1398 YQVK----SSLCDICEGADCG----EGCKKD 1420
            |..:    .|:|..| |:||.    :|.:.|
Zfish  1431 YTSERRRDMSVCSFC-GSDCSLCGTQGFRTD 1460

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Tep2NP_523506.1 A2M_N 115..209 CDD:280081 33/94 (35%)
A2M_N_2 445..576 CDD:285005 36/146 (25%)
A2M 694..782 CDD:278630 32/93 (34%)
A2M_2 909..1198 CDD:239227 112/296 (38%)
A2M_comp 961..1199 CDD:284982 88/245 (36%)
A2M_recep 1308..1398 CDD:284981 26/90 (29%)
cd109XP_697512.6 A2M_N 129..220 CDD:280081 33/94 (35%)
A2M_N_2 510..632 CDD:285005 34/139 (24%)
A2M 727..817 CDD:278630 32/93 (34%)
A2M_2 939..1228 CDD:239227 112/298 (38%)
A2M_comp 991..1230 CDD:284982 89/248 (36%)
A2M_recep 1347..1431 CDD:284981 26/90 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C120092918
eggNOG 1 0.900 E1_COG2373
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D177369at33208
OrthoFinder 1 1.000 FOG0000048
OrthoInspector 1 1.000 T597138
orthoMCL 1 0.900 OOG5_130297
Panther 1 1.100 LDO PTHR11412
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R4041
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
109.780

Return to query results.
Submit another query.