DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Tep2 and c4

Sequence 1:NP_523506.1 Gene:Tep2 FlyBaseID:FBgn0041182 Length:1420 Species:Drosophila melanogaster
Sequence 2:XP_005157429.1 Gene:c4 ZFINID:ZDB-GENE-030131-5697 Length:1700 Species:Danio rerio

Alignment Length:1649 Identity:415/1650 (25%)
Similarity:690/1650 (42%) Gaps:344/1650 (21%)


  Fly    13 YALLVNATGIYSV---------VGPGTLRSNSKYNVVVSVHKADGPSQIKVSLNGPSYNETK--- 65
            |.|.....|||.|         |.|..:....:..|.|.:|.|  ..:|::.|......|::   
Zfish     3 YHLFFVVFGIYVVDAQKPTCLIVAPNVIHLGVEETVGVQLHGA--TKEIRMKLYFEKQKESEILS 65

  Fly    66 QIELPPMSTQN-----VEFEVPKLATG----NYNLSAEGVSGVVF--KNSTKLN--YADKKPSVF 117
            :|....::..|     |:.:|.....|    |..:....:|..:|  :::.|.|  .:.|:..:|
Zfish    66 EIRSIILNENNNYQAVVKLKVDATMYGDVEKNSYVQLAAISNDIFEKQDARKANIYLSTKRGYIF 130

  Fly   118 VQTDKATYKPADLVQFRILFLDENTRPAKIEKPISVIIIDG--AQNR---IKQLSDVKLTKGVFS 177
            |||||..|.|.:.|::||..||....|.:.|..:.:....|  ..||   |.|:.|..:|     
Zfish   131 VQTDKPIYNPGENVKYRIFILDNYMLPIQDELHVQITNSKGLIVYNRVLIINQILDKTIT----- 190

  Fly   178 GELQLSEQPVLGTWKISVSVD--GDNRETKSFEVDKYVLPKFEVIVDTPKAV-VIADKVIKATIR 239
                :.|....|.|||..|..  .::..|..|||.:||||.|||.::..:.. ::..:.....|.
Zfish   191 ----IPEVEQTGKWKIITSFHKFPESTTTVEFEVKEYVLPTFEVKIEASQPYHILMSESFPFNIS 251

  Fly   240 AKYTYGKPVKGKATVSMERSYGYFGDLNANGNK-----QEKTIDV-DG----------------- 281
            |:|||||.|.|.|       |..||.::...||     .||.|.| ||                 
Zfish   252 ARYTYGKGVNGIA-------YVRFGLVDEKHNKIYLPGTEKQITVEDGTAGTAVLTKDLKTASQN 309

  Fly   282 --KGHVEFDIIHWAQRGQYLPPIKLFAVVTEELTGNKQNA-TATVVLHQQRYSIEPYERPEHFEA 343
              :|::|         |.|   |.:...|.::.:|..:.| :::|.:....|.::..:...:|..
Zfish   310 ITQGYIE---------GYY---IYIAVSVLDKASGMLEEAESSSVKIVTSPYVVDLSKTKTYFTP 362

  Fly   344 NKSFIYQVVVKNVDGSPVTNSAKNVKIGFDKSYSYFHEPSPKTRINFEAPVNENGIATFNVRL-P 407
            ...|.........||    |.|.|:|  |..:.:.  :.|.:..:..|:..||.|....:.:: |
Zfish   363 GGVFSVLATATYPDG----NRAPNLK--FTATITI--DGSSEQILQNESWGNEMGDVAMSFQIPP 419

  Fly   408 DSDSRYYRIFASFDGSENTIGSISKFEPTPMSREP---LKIQVNTKKPRLGEQVSFDVVSIEDL- 468
            .:.:....:||. .|.:..|.|.:|...:.::.|.   |.::|..:..:.||.:.   ..:.|: 
Zfish   420 QAKNLAITVFAE-GGDQVVIRSDNKMTASAITAEEQSYLSLEVEKQFLQAGEDLK---ARLRDIT 480

  Fly   469 ------PYFVYTIV-ARGNVILSDYVDVPDGQKTYTVKFTPTFSMVPKATIYVYYVVNN----DL 522
                  |.|.|.:| ::|.::  ....||....| ||.......|||...:..||...:    .:
Zfish   481 PEGAAKPTFFYFMVWSKGQIV--QMGRVPRTAFT-TVNVKVNVDMVPSFRLVAYYFTGSASKESV 542

  Fly   523 QFEEKTIDFEKEFSNSIDVSAPTNAKPSEEVKLRIKTDADSFVGLLGVDQSVLLLKSGNDLSQDD 587
            ..:...:|.:......|:::.....||:.:.::.::|:..:.|.|:.||.:|.:|.. |.||...
Zfish   543 VADSVWVDVKDVCKGKIEINPLAEIKPATQFEVTVETNPKTKVALVAVDSAVYILNK-NKLSLQK 606

  Fly   588 IFNSLNIYQTSTPWMNGYGRYPG---QTSGLVTLTNA------------------------NYPY 625
            :|:.:|.|..:.  ..|.|....   |.:||..:.|.                        :|..
Zfish   607 MFDYMNSYDLAC--SVGGGEDSSAVLQRAGLTFICNCALKTPTALEHKCNKKTTNRVRRAPDYVA 669

  Fly   626 NTGPLVMSY-------VFEGSRHPWITRPRYRVGIRGDSGDRISFLSQS-------------LND 670
            ....:|.|:       ..:|      .||.   .::....||:..:.:|             .::
Zfish   670 KYNAVVNSFKNQDRKCCLDG------VRPS---KMQTSCVDRLKRVKESESCRKAFKECCEAADE 725

  Fly   671 RNLKEILLKQTPQRTT--------------------IRKEFPETWFFENVGEEEFTLTKK---IP 712
            |..:|   |...::|:                    ||..||::|.:..:..:...|.:.   .|
Zfish   726 RRKRE---KFEKRKTSLGRVVGDSFDEIVINEDLIYIRNYFPQSWMWTVIESDNKGLIRHEVVAP 787

  Fly   713 DTITSWVVTGFSLNPTSGIALTKNPSKIRVFQPFFVSTNLPYSVKRGEVIAIPVVIFNYLDKTLD 777
            |:||:|.|....::||.|..:.: |..:.||:.||:|.||||||||.|.:.:..|::||..::| 
Zfish   788 DSITTWEVQAVGISPTKGFCIAE-PKPLTVFKDFFLSVNLPYSVKRNEQLQVKAVVYNYKQESL- 850

  Fly   778 ADVVMDNSDQEYEFTEATNEVLEKAIDEVRRVKRVTIPANSGKSVSFMIRPKNVGFTTLKITA-T 841
             .|::..:..|...|...|:|.|:          ||:..||..:|.|.:.|..:|...:.:.| .
Zfish   851 -KVIVKLNKVEGLCTAGGNDVKEE----------VTVSGNSAVTVYFTVVPLIIGNLHIDVLAYA 904

  Fly   842 SALAGDAIHQKLKVEPEGVTLFENRAVFI--NLKDQPEMSQSLDADI--PNEVVPQSEFIEFSV- 901
            |.:..|.:.:||:||.||.....:|...|  |||       .::.:|  |.:.||.....|.|: 
Zfish   905 SEIIHDRVEKKLRVEGEGELTSIDREFNIDPNLK-------KIEFNISSPVDEVPAGSDSETSLG 962

  Fly   902 -VGDLLGPTLQN------LDNLVRMPYGCGEQNMVNFVPNILVLKYLEVTGRKLPSVES----KA 955
             .|.::|.::.|      :|.|:::|.||.||.||...|.|..::||:.|.:.| |:::    :|
Zfish   963 FKGGVMGESIDNCLNLEGIDKLIQLPTGCAEQTMVKMSPAIHAMRYLDATNQWL-SLKAERRDEA 1026

  Fly   956 RKFLEIGYQRELTYKHDDGSYSAFGKSDASGSTWLTAYVMRSFHQAGTYTDIDPKVITAGLDFLV 1020
            |..::.||...||:|.|||||.||.::.:  |.||||::.:....:....:::...|...:.:|:
Zfish  1027 RSMIQTGYNTVLTHKKDDGSYGAFLRTPS--SIWLTAFIAKELTGSQDIVNVNKLYIQEAMSYLI 1089

  Fly  1021 SKQKESGEFPEVGKLFDNANQ-------NPLALTSFVLLAFFENHELIPKY--------QSAIKK 1070
            ||||.:|.:.:..:|||...:       :.:.||:|||::.   |..:..|        :.|:.|
Zfish  1090 SKQKSNGAWDDPNRLFDQGMKGGVEQATDDVPLTAFVLISM---HHALKVYDLGSDTELRVAMDK 1151

  Fly  1071 AVRYVAEEADKTDDQYSLAIAAVALQLAKHPQSE--KVIAKLESVARKENDRMWWSKATESTGED 1133
            |..|:..:.|.....||||:.|.:..|..|..:|  |...||:.:|..::...:| ||....||.
Zfish  1152 AKSYLEAQLDAVRSPYSLAVTAYSFSLHDHRSAEARKAQQKLQDIANCDDKMCFW-KAKGGRGEP 1215

  Fly  1134 GRVFHWKPRSNDVEITSYVLLALLEKDPAEKALPIIKWLISQRNSNGGFSSTQDTVIGLQALTKF 1198
            ..    |..:..||.|:|.||..|......|:..|..||..||...|||.||||||:.|:||||:
Zfish  1216 KD----KADARSVETTAYALLTTLIVGDKSKSKLIANWLTEQRRHGGGFRSTQDTVLALEALTKY 1276

  Fly  1199 AYKTGSGSG-TMDIEFSSAGESKNTIKVNPENSLVL---QTHDLPKSTRKVDFTAKGTGSAMVQL 1259
            :.:...... .:.:|.......|..:.:...|:|.|   :..|:.|.|..:..|.:|| .|:|| 
Zfish  1277 SIQNNDVDDLNLRVEMCLENGQKKDLHLTKNNALTLSAVKVRDVGKVTLNIQGTGRGT-LAVVQ- 1339

  Fly  1260 SYRYNLAEKEKKPSFKVTPTVK-----DTPN-QLLIVDVCAEY---------------------- 1296
            :||....::.....|.:|.|||     .|.| |.|:.|....|                      
Zfish  1340 TYRTMKKDESFCDLFHLTVTVKGELEYKTDNSQDLLEDYYESYDTSEAQNDEPMSNMQWFDLRSR 1404

  Fly  1297 -------VPLEDAD---------KDKDS-NMAVMEIALPSGFVGDSTSL-----GKIQAVDRVKR 1339
                   .|::::.         |.|:| .|.:::|:|.||.:.:|..|     |..:.:|..:.
Zfish  1405 RKRQISEEPIKESSLIYTVCVGLKKKNSEGMIIVDISLLSGLIPNSKDLEHNVKGTEKYIDHYEI 1469

  Fly  1340 VETKNSDSTVVVYFDSLTPGDVRCLPLEASKAHAVAKQKPASVSLYDYYDTERKATEYYQVK--- 1401
            ...|     |.:||..:|..: .||...|.:|..:...:|||..:||||..|::...:|...   
Zfish  1470 HHNK-----VYLYFAKITETE-ECLQFGADQAVPMGLVQPASAVIYDYYSPEKRCGIFYTAPQKS 1528

  Fly  1402 ---SSLC--DICEGADCGE-GCKK 1419
               |.||  |:|   .|.| ||.|
Zfish  1529 PMISKLCQGDVC---TCAEGGCAK 1549

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Tep2NP_523506.1 A2M_N 115..209 CDD:280081 31/101 (31%)
A2M_N_2 445..576 CDD:285005 29/143 (20%)
A2M 694..782 CDD:278630 31/91 (34%)
A2M_2 909..1198 CDD:239227 103/316 (33%)
A2M_comp 961..1199 CDD:284982 84/255 (33%)
A2M_recep 1308..1398 CDD:284981 27/96 (28%)
c4XP_005157429.1 A2M_N 128..220 CDD:280081 31/101 (31%)
A2M_N_2 459..595 CDD:285005 29/142 (20%)
ANATO 675..731 CDD:237984 10/68 (15%)
A2M 766..856 CDD:278630 31/93 (33%)
complement_C3_C4_C5 977..1276 CDD:239226 102/310 (33%)
A2M_comp 1032..1278 CDD:284982 84/256 (33%)
A2M_recep 1434..1522 CDD:284981 26/94 (28%)
NTR_complement_C4 1540..1698 CDD:239639 6/14 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C119605696
eggNOG 1 0.900 E1_COG2373
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D177369at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 LDO PTHR11412
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
54.900

Return to query results.
Submit another query.