DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Tep2 and Mcr

Sequence 1:NP_523506.1 Gene:Tep2 FlyBaseID:FBgn0041182 Length:1420 Species:Drosophila melanogaster
Sequence 2:NP_524688.1 Gene:Mcr FlyBaseID:FBgn0267488 Length:1760 Species:Drosophila melanogaster

Alignment Length:1663 Identity:405/1664 (24%)
Similarity:710/1664 (43%) Gaps:349/1664 (21%)


  Fly    23 YSVVGPGTLRSNSKYNVVVSVHKADGPSQIK-------VSLNGPSYN------ETKQIELPPMST 74
            |.:|....:|....|.|.||:.:|..|..:.       |.::|.|.:      ||..:.:||.| 
  Fly   132 YFIVASRMVRPGLIYQVSVSILQAQYPITVHASIACDGVQISGDSKDVKEGIPETLLMRIPPTS- 195

  Fly    75 QNVEFEVPKLATGNYNLSAEG-----VSGVVFKNSTKLNYADKKPSVFVQTDKATYKPADLVQFR 134
                      .||:|.|..||     ..|:.|.|.|:|:::.:..::||||||..|...:.|:||
  Fly   196 ----------VTGSYKLRVEGFYQNVFGGLAFLNETRLDFSQRSMTIFVQTDKPLYMQGETVRFR 250

  Fly   135 ILFLDENTRPAKIEKPISVIIIDGAQNRIKQLSDVKLTKGVFSGELQLSEQPVLGTWKISVSVDG 199
            .:.:  .|.....:.|:.|.::|..::.:|:....:...|..|.|.:||:||..|.|.|.|...|
  Fly   251 TIPI--TTELKGFDNPVDVYMLDPNRHILKRWLSRQSNLGSVSLEYKLSDQPTFGEWTIRVIAQG 313

  Fly   200 DNRETKSFEVDKYVLPKFEVIVDTPKAVVIADKVIKATIRAKYTYGKPVKGKATVSME-RSYGYF 263
            ...|: .|.|::|...:|||.|..|......|..|...:.|.:|.|.||:|..|:... |..|||
  Fly   314 QQEES-HFTVEEYYQTRFEVNVTMPAYFFTTDPFIYGRVMANFTSGLPVRGNLTIKATIRPIGYF 377

  Fly   264 GDL--------------------------NANGNKQEK-----TIDVDG---------------K 282
            .:.                          |.|.|.|.:     .:..||               :
  Fly   378 SNQVLNEKYRLGRSPLEQTNLYNERWRYNNPNQNPQVQYNVPGQLPQDGADLSQDILYRNQYVVE 442

  Fly   283 GHVEFD--IIHWAQRGQY---------------LP-------------PIKLFAVVTEELTGNKQ 317
            .|.:||  ...|.::.:|               ||             |::...::...|..::.
  Fly   443 RHYQFDEEWPFWVRKPEYQDSSYEAWSGTYRKTLPYLRYFNGTFDFKWPLRELELLVPNLANSEV 507

  Fly   318 NATATVVLHQQRYS--IEPY----------------ERPEHFEANKSFIYQVVVKNVDGSPVTNS 364
            ..||||  .::.|.  |..|                :.|:.|:....|...:.|:..||||:..:
  Fly   508 LITATV--GEKFYDEIISGYSVARVYNSSLRVVFLGDSPQVFKPAMPFTTYLAVEYHDGSPIDPN 570

  Fly   365 AKNVKI----GFDKSYSYFHEPSPKTRINFEAPVNE----------------------------N 397
            .....:    ||.:|.:......|..|:    |:::                            |
  Fly   571 LLRQGLMEVSGFVESRNGGRRDWPAQRL----PMSQQSDGIWEVKIDIRNDLNLDDRPQARDFLN 631

  Fly   398 GIATFNVRLPDSDSRYYRIFASFDGSENTIGSISKFEPTPMSREPLKIQVNTKKPRLGEQVSFDV 462
            |:....::....|.|..||       :..:..:|.:.|   ..:.:|:..:|:||.:||.:.|.:
  Fly   632 GVQNMRLQANFVDPRGERI-------QTELLLVSHYSP---RNQHIKVTTSTEKPVVGEYIIFHI 686

  Fly   463 VSIEDLPYFVYTIVARGNVILSDYVDVPDGQKTYTVKFTPTFSMVPKATIYVY------YVVNND 521
            .:...|..|.|.|:::|.::::|...:.:|.||..|..:.  .|.|.|||.|:      .||.:.
  Fly   687 RTNFYLEEFNYLIMSKGVILVNDRETITEGIKTIAVVLSS--EMAPVATIVVWKINQQGQVVADS 749

  Fly   522 LQFEEKTI---DFEKEFSNSIDVSAPTNAKPSEEVKLRIKTDADSFVGLLGVDQSVLLLKSGNDL 583
            |.|....|   :|....:|       ..|:..|:|::.|..:..|:|||.|:|.:...:::||:|
  Fly   750 LTFPVNGISRNNFTVYINN-------RKARTGEKVEVAIFGEPGSYVGLSGIDSAFYTMQAGNEL 807

  Fly   584 SQDDIFNSLNIYQTSTP------WMNGYGR------YPGQTSGLVTLTNANYPYNTGPLVMSYVF 636
            :...|...::.:...|.      |.:..|.      :|..:.|:.  .|..:.| :|.:|.:..:
  Fly   808 TYAKIITKMSNFDEQTNGTYKHIWYSHEGNPDELVYFPASSFGVD--ANRTFEY-SGLIVFTDGY 869

  Fly   637 EGSRHPWITRPR----------YRVGIR-------GDSGDRISFLSQSLNDRNLKEILLKQTPQR 684
            ...|.....|..          ||:..:       .|..|.|     :.:.||..|:|..:..:.
  Fly   870 VPRRQDTCNRTLGFGECLSGRCYRLEKQCDGLFDCDDGTDEI-----NCHARNDTELLNYRKYRF 929

  Fly   685 TTIRKEFPETWFFE--NVGEE-EFTLTKKIPDTITSWVVTGFSLNPTSGIALTKNPSKIRVFQPF 746
            ..:.:.:...|.::  |:|.. .:....::||....|:|:.||::|:.|..:.....:....|||
  Fly   930 NRVLRHYENVWLWKDVNIGPHGRYIFNVEVPDRPAYWMVSAFSVSPSKGFGMMNKALEYVGVQPF 994

  Fly   747 FVSTNLPYSVKRGEVIAIPVVIFNYLDKTLDADVVMDNSDQEYEFTEATNEVLEKAIDEVRRVKR 811
            |::..:|.:.::||.:.|.|.:|||:...::|.||:.:| .:|:|.....:.:.::.:       
  Fly   995 FINVEMPEACRQGEQVGIRVTVFNYMITPIEAIVVLHDS-PDYKFVHVEEDGIVRSYN------- 1051

  Fly   812 VTIPANS-------------GKSVSFM-IRPKNVGFTTLKITATSALAGDAIHQKLKVEPEGVTL 862
               |..|             |.:|.:: :.|:.:|...:.:...:.|..|.|.:.|.||.:|:..
  Fly  1052 ---PRTSFGEHQFFIYLEAQGTTVVYVPVVPQRLGNVDVTLHVATLLGTDTITRTLHVESDGLPQ 1113

  Fly   863 FENRAVFINLKDQPEMSQSLDA------DIPNEV----VPQSEFIEFSVVGDLLGPTLQ----NL 913
            :.:::|.::|.::..:.:.:..      :||.:|    |..|.....|||||::||...    |.
  Fly  1114 YRHQSVLLDLSNRAYVLEYMHVNVTQTPEIPYQVDRYFVYGSNKARISVVGDVVGPIFPTMPVNA 1178

  Fly   914 DNLVRMPYGCGEQNMVNFVPNILVLKYLEVTGRKLPSVESKARKFLEIGYQRELTYKHDDGSYSA 978
            .:|:.:|...||||..:|..|:..:.|:.:..::..::|..|...:.|||||:|::...|||:|.
  Fly  1179 SSLLSLPMESGEQNAFSFAANLYTIMYMRLINQRNKTLEKNAFYHMNIGYQRQLSFMRPDGSFSL 1243

  Fly   979 FGKSD---ASGSTWLTAYVMRSFHQAGTY-----TDIDPKVITAGLDFLVSKQKESGEFPEVGKL 1035
            | :||   :..|.|||:|.:|.|.:|..|     ..||..:|...:.:|:..|...|.|.||..|
  Fly  1244 F-RSDWNNSDSSVWLTSYCLRVFQEASFYEWENFIWIDATIIEKNMRWLLQHQTPQGSFFEVTWL 1307

  Fly  1036 FD------NANQNPLALTSFVLLAFFENHELIPKYQS----AIKKAVRYVAEEADKTDDQ---YS 1087
            .|      |.::| :.|||.||:......::.....|    |.::|:.|:....|....|   :.
  Fly  1308 PDRKMNRTNFDKN-ITLTSHVLITLATVKDISGTLGSRVALATQRALAYIERNMDFLRHQAQPFD 1371

  Fly  1088 LAIAAVALQLAKHPQSEKVIAKLESVARKENDRMWWSKATESTGEDGRVFH---W--KPR----- 1142
            :||.|.||||...|.:|:|.|.|...||...|.|:|  ..:...:..|...   |  .||     
  Fly  1372 VAITAYALQLCNSPIAEEVFAILRRQARTIGDFMYW--GNQEIPQPPRKLENQKWFSLPRLPYEY 1434

  Fly  1143 -SNDVEITSYVLLALLEKDPAEKAL---PIIKWLISQRNSNGGFSSTQDTVIGLQALTKFAYKT- 1202
             |.::|.|:|.||..:    |.:..   ||::||.|||.::||::|||||...|:||.::..:: 
  Fly  1435 DSLNIETTAYALLVYV----ARREFFVDPIVRWLNSQRLNDGGWASTQDTSAALKALVEYTVRSR 1495

  Fly  1203 --GSGSGTMDIEFSSAGESKNTIKVNPENSLVLQTHDLPKSTRKVDFTAKGTGSAMVQLSYRYNL 1265
              ...|.|::||.||.|....|:.::..|...||:.::|.:...:...|||.|.|::|:..:||:
  Fly  1496 LREVSSLTVEIEASSQGGKTQTLYIDDTNLAKLQSIEIPDAWGTIKVQAKGAGYAILQMHVQYNV 1560

  Fly  1266 -----AEKEKKPSFKV-TPTVKDTPNQLLIVDV-CAEYVPLEDADKDKDSNMAVMEIALPSGFVG 1323
                 ..|...|:|.: |..:....||..|..| |..::...::::   |.|||:::|:|:|:..
  Fly  1561 DIEKFQTKPPVPAFGLHTKAIFHGRNQSHISYVACQNWINQNESER---SGMAVLDVAIPTGYWI 1622

  Fly  1324 DSTSL------GKIQAVDRVKRVETKNSDSTVVVYFDSLTPGDVRCLPLEASKAHAVAK-QKPAS 1381
            ....|      .:::.:.|.:.:|.|     :|.|||.|...|: |:.....:.:.||. .:...
  Fly  1623 QQQKLDTYVLSNRVRNLRRARYLERK-----IVFYFDYLDHEDI-CVNFTIERWYPVANMSRYLP 1681

  Fly  1382 VSLYDYYDTER------KATEYYQVKSSLCDICEGADC 1413
            |.:||||..||      .|...|.:  ::|::|..:.|
  Fly  1682 VRIYDYYAPERFNESIFDALPTYLL--NICEVCGSSQC 1717

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Tep2NP_523506.1 A2M_N 115..209 CDD:280081 29/94 (31%)
A2M_N_2 445..576 CDD:285005 39/140 (28%)
A2M 694..782 CDD:278630 26/91 (29%)
A2M_2 909..1198 CDD:239227 103/328 (31%)
A2M_comp 961..1199 CDD:284982 91/273 (33%)
A2M_recep 1308..1398 CDD:284981 28/103 (27%)
McrNP_524688.1 A2M_N 232..332 CDD:280081 33/103 (32%)
A2M_N_2 669..799 CDD:285005 39/139 (28%)
LDLa 886..913 CDD:238060 5/32 (16%)
A2M 940..1030 CDD:278630 26/90 (29%)
ISOPREN_C2_like 1177..1490 CDD:298658 103/321 (32%)
A2M_comp 1226..1492 CDD:284982 91/274 (33%)
A2M_recep 1607..1695 CDD:284981 27/94 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG2373
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D177369at33208
OrthoFinder 1 1.000 FOG0000048
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR11412
RoundUp 00.000 Not matched by this tool.
44.010

Return to query results.
Submit another query.