DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Tep2 and F13D2.1

Sequence 1:NP_523506.1 Gene:Tep2 FlyBaseID:FBgn0041182 Length:1420 Species:Drosophila melanogaster
Sequence 2:NP_001263970.1 Gene:F13D2.1 WormBaseID:WBGene00008735 Length:1659 Species:Caenorhabditis elegans

Alignment Length:1577 Identity:290/1578 (18%)
Similarity:559/1578 (35%) Gaps:456/1578 (29%)


  Fly    38 NVVVSVHKADGPSQIKVSLNGPSYNETKQIELPPMSTQNVEFEVPKLATGNYNLSAEGVSGVVFK 102
            ||:..|::....:.:::...|...|:..|.|     .|.:.|         :..|::..:.:|.|
 Worm    34 NVITIVNEKSVKTVVQIDHGGEKTNKEIQGE-----HQIISF---------HTSSSQSFAHIVIK 84

  Fly   103 NSTKLNYADKKP------SVFVQTDKATYKPADLVQFRILFLDENTRPAKIEK-PISVIIIDG-- 158
            ...::......|      :|.:..|||.|:.::||..|||.|   |....|.: .:|:.:::|  
 Worm    85 VDGEVELDQNVPVRPDLFNVHIHIDKAVYRKSELVNVRILPL---THSGSIYRGDLSITLVNGKG 146

  Fly   159 ----AQNRIKQLSDVKLTKGVFSGELQLSEQPVLGTWKISVS-VDGDNRE-------TKSFEVDK 211
                :..|:|::.:   |..:.|.:|::......|.|.:.|. |:..:::       .|:|:|..
 Worm   147 FVESSTMRVKRVEE---TDSMISDQLEIPSHTFFGDWFLKVQPVEYGSKKIDEMLVFEKTFQVQD 208

  Fly   212 YVLPKFEV---IVDTPKAVVIADKVIKATIRAKYTYGKPVKGKATVSMERSYGYFGDLNANGNKQ 273
            |.||.:.:   :||...    .||. ..|:.|||.:||||.|...|       |..::.::.   
 Worm   209 YDLPNYRLNGFLVDNSD----LDKT-TVTVEAKYFHGKPVNGSVHV-------YCREVGSSS--- 258

  Fly   274 EKTIDVDGKGHV------EFDIIHWA---QRGQYLP----PIKLFAVVTEELTGNKQNATATVVL 325
                  ..:.|:      |||...|:   ..|:..|    |.:::....|..||.:|:....:.:
 Worm   259 ------QDRSHLTHLRSGEFDNGIWSSIVDLGKCDPPNPLPKEIYIESRENGTGYRQDLILGLDV 317

  Fly   326 HQQRYSI---EPYERPEHFEANKSFIYQV--VVKNVDGSPVTN----------SAKN-------- 367
            ...:::|   .||           |...|  ::..|||..:.:          |.||        
 Worm   318 MAPKFTITAVRPY-----------FTNDVEEIILLVDGDGIAHGNVSIRIECISEKNDVMRTKEV 371

  Fly   368 ---------VKIGFDKSYSYFHEPSPKTRINFEAPVNENGIATFNV----RLPDSDSRYYRIFAS 419
                     :|||..|.:                   :|.::...|    |:.:..|....::..
 Worm   372 KVGSKIGDALKIGIPKEW-------------------QNDVSVIRVIANRRIKNGFSNDTMLYIP 417

  Fly   420 FDGSENTIGS-ISKFEPTPMSREPLKIQVNTKKPRLGEQVSFDVV----SIEDLPYFVYTIVARG 479
            ...:.:.:.| ||..|..|..::...:.|:.|..|  ::.:|.::    ::..:|..|...:.|.
 Worm   418 NLSNTSLVSSLISPEEIKPFYKDDEIMNVHVKNTR--KETNFVIICNSHTVHRVPNEVKNRILRV 480

  Fly   480 NVILSDYVDVPDGQKTYTVKFTPTFSMVPKATIYVYYVVNN--DLQFEEKTI--DFEKEFSNSID 540
            .:     .|..:|....|. ||...|:   :.:.::.|..:  |.:.:...:  ...||..|:..
 Worm   481 KI-----TDKMEGTCILTA-FTADSSV---SDVMLFRVQTHCEDCKVKVSKVLNGMSKELGNNDA 536

  Fly   541 VSAPTNAKPSEEVKLRIKTDADSFVGLLGVDQSVLLLKSGNDLSQDDIFNSLNIYQTSTPWMNGY 605
            :      :|.:.::|.....:::.|....:|:.:..:...||....:..:.|...:.|       
 Worm   537 I------EPGDVMELEFTGHSEAIVFYRAMDERLNYITLRNDYMIHEYLDYLIFGKQS------- 588

  Fly   606 GRYPGQTSGLVTLTNANYPYNTGPLVMSYVFEGSRHPWITRPRYRVGIRGDSGDRISFLSQSLND 670
                 |.:.::.|.||.            ..|.:.....|...:::..|...|.|.:.|   :::
 Worm   589 -----QGAKILNLVNAE------------KVEHAMKKMCTSAGHQLRFRCLQGQRSTSL---VSE 633

  Fly   671 RNLKEILL--------------------KQTP--------------------------------- 682
            :.||.:|.                    |.||                                 
 Worm   634 KCLKHVLKSCYKNSSATAMQIVTPYLSGKTTPVLSASSTNWLDNINVFRSKSMKAPLQLFVKPEF 698

  Fly   683 -------QRTTIRKEFPETWFFENV-----GEEEFTLTKKIPDTITSWVVTG-------FSLNPT 728
                   |::.||:.|||||.|:.:     |.::.|.|.  ||.:..|.:..       .||.| 
 Worm   699 HDPGVVSQKSRIRQHFPETWLFDAIVLERNGTKKITATS--PDNVGQWALNNAYWWHGRVSLYP- 760

  Fly   729 SGIALTKNPSKIRVFQPFFVSTNLPYSVKRGEVIAIPVVIFNYLDKTLDADVVMDNSDQEYEFTE 793
               ..||   .|:..:..|:..::|.:|...|.|: |::....:|..                  
 Worm   761 ---GQTK---YIQTSKAIFLEVDMPRNVYVNETIS-PLLTITGVDLV------------------ 800

  Fly   794 ATNEVLEKAIDEVRRVKRVTIPANSGKSVSFMIRPK-------------------NVGFTTLKIT 839
            .:.|.|...:.|:.|.......||..|..::.::.:                   .|...||.:.
 Worm   801 KSRETLVICLSELPRKVCADQGANGKKGDTYYMKVEVSRSSPIQSKYLMMKFLSPGVVNMTLTLK 865

  Fly   840 ATSALAG---DAIHQKLKVEPEGVT--------LFENRAVFINLKDQPEMSQSL----------- 882
            ..:...|   ||:.::::::....|        |..::.:...:.|.|..:.|.           
 Worm   866 TENCQTGKILDAVRKQIEIQKRADTEEYYERHILNPSKPLVTAMNDDPGSTSSRNTKMITFSDQH 930

  Fly   883 ----DADIPNEV----VPQSEFI-EFSVVGDLLGPTLQNLDNLVRMPYGC-----GEQNMVNFVP 933
                :||..|.:    ||.:|.: .||:.   |...|...|.:.::|.|.     |::.:.:.:.
 Worm   931 GSMDEADTINTLITSNVPDTETVFSFSIT---LSKFLPITDKIGKIPIGTRSKRNGQRILTSVIK 992

  Fly   934 NILVLKY----LEVTGRKLPSVESKARKFL-EIGYQRELTYKHDDGSYSAFGKSDAS--GSTWLT 991
            .:.::.|    |::.|.....:|::....: |:......|.:.:..:||.|||..||  .|..||
 Worm   993 ELSIVLYKFKKLKLYGSTSYQMEAEINDLINEMMQFSNCTSQKEPCAYSEFGKPQASNEASILLT 1057

  Fly   992 AYVMRSFHQAGTYTDIDP-------KVITAGLDFLVSKQKESGEFPEVGKLFD--NANQNPLALT 1047
            :.......:|    |::.       |.|||.:..|  .:|:..|  ::..:.|  |.......|.
 Worm  1058 SIATSLLCEA----DVEENRILGSLKTITAYIPKL--GRKDFNE--DLSDIIDVENTEDKKYLLV 1114

  Fly  1048 SFVLLAFFENHELIPKYQSAIKKAVR---------YVAEEADKTDDQYSLAIAAVALQLAKHPQS 1103
            ||:    ::.......|:|.::...:         |..:|:...|.:.|.|||.:|.........
 Worm  1115 SFM----YQVSRDCSSYRSGLRDMTKSFGKLHKYFYELDESAVQDRRTSAAIAFMATNATAELMR 1175

  Fly  1104 EKVIAKLESVARKENDRMWWSKATESTGED-----GRVFHWKPRSNDVEITSYVLLALL------ 1157
            ..:||::    .||:...|.....::...|     ...|..:..|..|.:.|:.|.|::      
 Worm  1176 SDLIAEI----NKEHPPYWKCNGYDTNRVDKLKRSSESFRRRRESCQVMVNSFALAAIVTAYAEG 1236

  Fly  1158 -EKDPAEKALPIIKWLISQRNSNGGFSSTQDTVIGLQAL-------TKFAYKTGSGSGTMDIEFS 1214
             |.|....|    .|:..|::|:|.:.|...|::..::|       .:.||     :..:::...
 Worm  1237 TEVDWDRLA----DWISEQQSSDGSYGSPLTTLVASRSLFEKSRRSVEIAY-----NDLLEVTVR 1292

  Fly  1215 SAGESKNTIKVNPENSLVLQTHDLPKSTRKVDFTAKGTGSAMVQLSYRYNLAEKEKKPSFKVTPT 1279
            ..|.|:..|.|...   .::.| :|.:...|....||.|.|:|               :.::..|
 Worm  1293 CKGCSEKRINVTES---AIEIH-IPNNIHYVTLITKGHGKAVV---------------AARIVAT 1338

  Fly  1280 VKDTPNQLLIVDVCAEYVPLE-DADKDKDSNMAVMEIALPSGFVGDSTSLGKIQAVDRVKRVETK 1343
            .:..|.:.|..|   :|.|:. ..|:....|.....:..       :.|...|:.:|......|.
 Worm  1339 KRPRPKRGLTQD---DYYPVHLSIDQKVQDNFVHQTVCF-------NVSNPTIKTLDIFHGTYTL 1393

  Fly  1344 NSDSTVVVYF--DSLTP 1358
            .:.:...:||  ||.||
 Worm  1394 FTATPDQLYFLNDSYTP 1410

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Tep2NP_523506.1 A2M_N 115..209 CDD:280081 26/109 (24%)
A2M_N_2 445..576 CDD:285005 22/139 (16%)
A2M 694..782 CDD:278630 22/100 (22%)
A2M_2 909..1198 CDD:239227 67/338 (20%)
A2M_comp 961..1199 CDD:284982 57/277 (21%)
A2M_recep 1308..1398 CDD:284981 11/54 (20%)
F13D2.1NP_001263970.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG2373
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11412
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.