DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Tep2 and A2ML1

Sequence 1:NP_523506.1 Gene:Tep2 FlyBaseID:FBgn0041182 Length:1420 Species:Drosophila melanogaster
Sequence 2:XP_011518868.1 Gene:A2ML1 HGNCID:23336 Length:1467 Species:Homo sapiens

Alignment Length:1605 Identity:439/1606 (27%)
Similarity:680/1606 (42%) Gaps:334/1606 (21%)


  Fly     1 MFRIFLTGIILQYALLVNATGIYSVVGPGTLRSNSKYNVVVSVHKADGPSQIKVSLNGPSYNET- 64
            |:...|.|::.....:......|.|..|..|...|...|.:.:  :.|.|.:|.::...:.::| 
Human     1 MWAQLLLGMLALSPAIAEELPNYLVTLPARLNFPSVQKVCLDL--SPGYSDVKFTVTLETKDKTQ 63

  Fly    65 KQIELPPMSTQN---VEFEVPKLATGNYNLSAEGVSGVVFKNSTKLNYADKKP--------SVFV 118
            |.:|...:..::   :.|.||..|.|...::...||||    ...:::.:||.        ..||
Human    64 KLLEYSGLKKRHLHCISFLVPPPAGGTEEVATIRVSGV----GNNISFEEKKKVLIQRQGNGTFV 124

  Fly   119 QTDKATYKPADLVQFRILFLDENTRPAKIEKPISVIIIDGAQNRIKQLSDVKLTKGVFSGELQLS 183
            ||||..|.|...|.|||:.:|.|..|.. :|...|.:.|...|||.|..:|...:|:.....||:
Human   125 QTDKPLYTPGQQVYFRIVTMDSNFVPVN-DKYSMVELQDPNSNRIAQWLEVVPEQGIVDLSFQLA 188

  Fly   184 EQPVLGTWKISVSVDGDNRETKSFEVDKYVLPKFEVIVDTPKAVVIADKVIKATIRAKYTYGKPV 248
            .:.:|||:.::|:   :.:...:|.|::||||||:|.|..||.:....:.....|..:||||||:
Human   189 PEAMLGTYTVAVA---EGKTFGTFSVEEYVLPKFKVEVVEPKELSTVQESFLVKICCRYTYGKPM 250

  Fly   249 KGKATVSM---ERSYGY-------FGDLNAN-GNKQEKT------IDVDGKGHVEFDIIHWAQRG 296
            .|...||:   ..:|.|       ..|...| ..:.:||      :|:     ..||:|.:|   
Human   251 LGAVQVSVCQKANTYWYREVEREQLPDKCRNLSGQTDKTGCFSAPVDM-----ATFDLIGYA--- 307

  Fly   297 QYLPPIKLFAVVTEELTGNKQNATATVVLHQQRYSIEPYERPEHFEANKSFIYQVVVKNVDGSPV 361
             |...|.:.|.|.||.||.:.|||..:.:..|..|:...:....:..|..|..::.|:..|.|.:
Human   308 -YSHQINIVATVVEEGTGVEANATQNIYISPQMGSMTFEDTSNFYHPNFPFSGKIRVRGHDDSFL 371

  Fly   362 TNSAKNVKI-GFDKSYSYFHEPSPKTRINFEAPVNENGIATFNVRL------------------- 406
            .|....:.| |.:.::            |.....:.||:|.|.:..                   
Human   372 KNHLVFLVIYGTNGTF------------NQTLVTDNNGLAPFTLETSGWNGTDVSLEGKFQMEDL 424

  Fly   407 ---PDSDSRYY-------RIF----ASFDGSENTIGSISKFEP---------TPMSREPLKIQVN 448
               |:...|||       |.|    .||.|.....|.:...:|         .|....|      
Human   425 VYNPEQVPRYYQNAYLHLRPFYSTTRSFLGIHRLNGPLKCGQPQEVLVDYYIDPADASP------ 483

  Fly   449 TKKPRLGEQVSFDVVSIEDLPYFVYTIVARGNVILSDYVDVPDGQK-----------TYTVKFTP 502
                  .:::||.           |.::.:|::::       :|||           ::::..|.
Human   484 ------DQEISFS-----------YYLIGKGSLVM-------EGQKHLNSKKKGLKASFSLSLTF 524

  Fly   503 TFSMVPKATIYVYY------VVNNDLQFEEKTIDFEKEFSNSIDV--------------SAPTNA 547
            |..:.|..::.:|.      ||.:.:||     ..|..|.|..|:              .:|:..
Human   525 TSRLAPDPSLVIYAIFPSGGVVADKIQF-----SVEMCFDNQADLIPKLYLSLPQVSLGFSPSQQ 584

  Fly   548 KPSEEVKLRIKTDADSFVGLLGVDQSVLLLKSGNDLSQDDIFNSLNIYQTSTPWMNGYGRYPGQT 612
            .|..||:|:::....|...|..||:|||||:...:||...::.....:         ||.||.|.
Human   585 LPGAEVELQLQAAPGSLCALRAVDESVLLLRPDRELSNRSVYGMFPFW---------YGHYPYQV 640

  Fly   613 SGLVTLTNANYPYNTGPLVMSYVF-----------EGSRHPWITRPRYRVGIRGDSGDRISFLS- 665
            :          .|:..|:...:.|           ..|:...|.||.:..|.     |..||.. 
Human   641 A----------EYDQCPVSGPWDFPQPLIDPMPQGHSSQRSIIWRPSFSEGT-----DLFSFFRD 690

  Fly   666 ---QSLNDRNLK-----------------------EILLKQTP----QRTTIRKEFPETWFFE-- 698
               :.|::..:|                       |.....||    :.:.:|:.|||||.::  
Human   691 VGLKILSNAKIKKPVDCSHRSPEYSTAMGAGGGHPEAFESSTPLHQAEDSQVRQYFPETWLWDLF 755

  Fly   699 ---NVGEEEFTLTKKIPDTITSWVV--------TGFSLNPTSGIALTKNPSKIRVFQPFFVSTNL 752
               |.|:|...:|  :||.||.|..        .||.|:||.|:.         .|:||||...|
Human   756 PIGNSGKEAVHVT--VPDAITEWKAMSFCTSQSRGFGLSPTVGLT---------AFKPFFVDLTL 809

  Fly   753 PYSVKRGEVIAIPVVIFNYLDKTLDADVVMDNSDQEYEFTEATNEVLEKAIDEVRRVKRVTIPAN 817
            ||||.|||...:...|||||...:.....:..| .||:        ||...|.   .....:.|:
Human   810 PYSVVRGESFRLTATIFNYLKDCIRVQTDLAKS-HEYQ--------LESWADS---QTSSCLCAD 862

  Fly   818 SGKSVSFMIRPKNVG---FT-TLKITATSALAG------------DAIHQKLKVEPEGVTLFENR 866
            ..|:..:.|....:|   || :.||..::...|            |.:.:.:.|:||||.:.:..
Human   863 DAKTHHWNITAVKLGHINFTISTKILDSNEPCGGQKGFVPQKGRSDTLIKPVLVKPEGVLVEKTH 927

  Fly   867 AVFINLKDQPEMSQSLDADIPNEVVPQSEFIEFSVVGDLLGPTLQNLDNLVRMPYGCGEQNMVNF 931
            :..:..|.: ..|:|:..::|.::||.|.....:|:||::|..|||||.||:||.||||||||.|
Human   928 SSLLCPKGK-VASESVSLELPVDIVPDSTKAYVTVLGDIMGTALQNLDGLVQMPSGCGEQNMVLF 991

  Fly   932 VPNILVLKYLEVTGRKLPSVESKARKFLEIGYQRELTYKHDDGSYSAFGKSDASGSTWLTAYVMR 996
            .|.|.||:|||..|.....:.|:|..|||||||:||.|||.:|||||||:.|.:|:|||||:|.:
Human   992 APIIYVLQYLEKAGLLTEEIRSRAVGFLEIGYQKELMYKHSNGSYSAFGERDGNGNTWLTAFVTK 1056

  Fly   997 SFHQAGTYTDIDPKVITAGLDFLVSKQKESGEFPEVGKLFDNANQ----NPLALTSFVLLAFFEN 1057
            .|.||..:..||||.|...|.::...|..||.:..||.|...|.:    :.::||::|..|..|.
Human  1057 CFGQAQKFIFIDPKNIQDALKWMAGNQLPSGCYANVGNLLHTAMKGGVDDEVSLTAYVTAALLEM 1121

  Fly  1058 HELIPKYQSAIKKAVRYVAEEADKTDDQYSLAIAAVALQLAKHPQSEKVIAK-LESVARKENDRM 1121
            .:.:.  ...:.:.:|.:...|..|.:.|:.|:.|....||.......::.| |:..|....:.:
Human  1122 GKDVD--DPMVSQGLRCLKNSATSTTNLYTQALLAYIFSLAGEMDIRNILLKQLDQQAIISGESI 1184

  Fly  1122 WWS-KATESTGEDGRVFHW-KPRSNDVEITSYVLLALLEKDPA------EKALPIIKWLISQRNS 1178
            :|| |.|.|:...    .| :|.:.|||:|:|.|||.|.| |:      .||..|:.||..|.|:
Human  1185 YWSQKPTPSSNAS----PWSEPAAVDVELTAYALLAQLTK-PSLTQKEIAKATSIVAWLAKQHNA 1244

  Fly  1179 NGGFSSTQDTVIGLQALTKFAYKTGSGSGTMDIEFSSAGESKNTIKVNPENSLVLQTHDLPKSTR 1243
            .||||||||||:.||||.|:|......|..:::...|....:.|..:...|.||.|...||....
Human  1245 YGGFSSTQDTVVALQALAKYATTAYMPSEEINLVVKSTENFQRTFNIQSVNRLVFQQDTLPNVPG 1309

  Fly  1244 KVDFTAKGTGSAMVQLSYRYNLAEKEKKPSFKVTPTV------KDTPNQLLIVDVCAEYVPLEDA 1302
            .....|.|.|...||...|||:.......:|.::..:      :.|..:.|.:.:...||     
Human  1310 MYTLEASGQGCVYVQTVLRYNILPPTNMKTFSLSVEIGKARCEQPTSPRSLTLTIHTSYV----- 1369

  Fly  1303 DKDKDSNMAVMEIALPSGFVGDSTSLGKIQAV---DRVKRVETKNSDSTVVVYFDSLTPGDVRCL 1364
            .....||||::|:.:.|||   |...|..|.:   ..||:||.  ...|:.:|.|.|.. :.:..
Human  1370 GSRSSSNMAIVEVKMLSGF---SPMEGTNQLLLQQPLVKKVEF--GTDTLNIYLDELIK-NTQTY 1428

  Fly  1365 PLEASKAHAVAKQKPASVSLYDYYDTERKATEYYQVKSSLCDICE 1409
            ....|::..|...|||::.:||||..:.:||..|.      |.||
Human  1429 TFTISQSVLVTNLKPATIKVYDYYLPDEQATIQYS------DPCE 1467

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Tep2NP_523506.1 A2M_N 115..209 CDD:280081 31/94 (33%)
A2M_N_2 445..576 CDD:285005 31/162 (19%)
A2M 694..782 CDD:278630 35/101 (35%)
A2M_2 909..1198 CDD:239227 127/302 (42%)
A2M_comp 961..1199 CDD:284982 96/251 (38%)
A2M_recep 1308..1398 CDD:284981 30/93 (32%)
A2ML1XP_011518868.1 A2M_N 122..211 CDD:280081 31/93 (33%)
YfaS <123..>1055 CDD:225248 284/1040 (27%)
A2M_N_2 455..613 CDD:285005 35/193 (18%)
A2M 749..839 CDD:278630 35/101 (35%)
A2M_2 969..1264 CDD:239227 127/302 (42%)
A2M_comp 1021..1266 CDD:284982 97/252 (38%)
A2M_recep 1375..1462 CDD:284981 30/93 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C120145992
eggNOG 1 0.900 E1_COG2373
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D177369at33208
OrthoFinder 1 1.000 FOG0000048
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11412
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.940

Return to query results.
Submit another query.