DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Tep2 and a2ml1

Sequence 1:NP_523506.1 Gene:Tep2 FlyBaseID:FBgn0041182 Length:1420 Species:Drosophila melanogaster
Sequence 2:XP_012809688.1 Gene:a2ml1 XenbaseID:XB-GENE-5943821 Length:1473 Species:Xenopus tropicalis

Alignment Length:1586 Identity:458/1587 (29%)
Similarity:696/1587 (44%) Gaps:323/1587 (20%)


  Fly     9 IILQYALLVNATGIYSVVGPGTLRSNSKYNVVVSVHKADGPSQIKVSLNGPSYNET------KQI 67
            ::|..:..:.|...|:||.|..:|.:|.....|.:..|:|.|:|:|:||....|.|      :|.
 Frog    12 VLLHLSGTLEAKLHYAVVFPSEMRCHSSEQACVHLSGAEGDSRIQVTLNMAERNSTVIERNLRQK 76

  Fly    68 ELPPMSTQNVEFEVPKLATGNYNLSAEGV----SGVVFKNSTKLNYADKKPSVFVQTDKATYKPA 128
            .|    ...|.|:||..:.||..::...:    :|....||:|:....::.|.|:|||||.|||.
 Frog    77 SL----FSCVTFQVPPPSEGNEEVATMEILIESAGETITNSSKVLVKRRRTSTFIQTDKAVYKPG 137

  Fly   129 DLVQFRILFLDENTRPAKIEKPISVI-IIDGAQNRIKQLSDVKLTKGVFSGELQLSEQPVLGTWK 192
            ..|:||::.|.||.:|.  |..|||| :.|..:|||.|..||.||:|:....|.||.:|.||.:.
 Frog   138 QTVRFRVVSLKENLQPG--ENQISVIQLQDPNKNRIAQWLDVTLTQGIAELSLPLSPEPSLGEYS 200

  Fly   193 ISVSVDGDNRETKSFEVDKYVLPKFEVIVDTPKAVVIADKVIKATIRAKYTYGKPVKG--KATVS 255
            |.|   ||.  ...|.|::||||||||....||.|....:..:.....:|||||||:|  ||||.
 Frog   201 IHV---GDT--VHYFSVEEYVLPKFEVSFQFPKVVFFTSEQFQLKTCGRYTYGKPVQGTYKATVC 260

  Fly   256 MERSYGYFGDLNANGNKQEKTIDVDGKGHVEFDIIHWAQRGQYLPPIKLFAVVTEELTGNKQNAT 320
            .:....::|.   |.::.:..:|..||    .|     |.|            ...||...:|..
 Frog   261 RKVIRYWWGH---NDDRSDLCVDFSGK----LD-----QSG------------CSTLTATSENFN 301

  Fly   321 ATVVLHQQRYS-----IEPYERPEHFEANKSFIYQVVVK----NVD-----GSPVTNSAKNVKIG 371
            .|...|:....     .|.....|:..:.|:.|..||..    :.|     |.|.:.:.|.|...
 Frog   302 LTYNTHEMGLEGTSTITEGGTGVEYSGSGKTIISSVVTSCSFLDADSNYKPGIPYSGTVKVVDAN 366

  Fly   372 FDKSYSYFHEPSP---------KTRINFEAPVNENGIATFNVR----------LPDSDSRYYRIF 417
            .|        |.|         ...:|.....:|||:|:|.:.          |..|.:.....|
 Frog   367 DD--------PIPNQIVYLTSHSNEVNKTLVSDENGLASFQLENTAEWKGQLSLRASTTTQDAGF 423

  Fly   418 ASFDGSENTIGSISKFEPTPMSREPLK--IQVNTKKPRLGEQVSFDVVSIEDLPYFV-------- 472
            ....|...|...:|..........|.|  :::::::..|..:...||    .:.|.:        
 Frog   424 DFLQGRLITPNDVSASLMLKPFHSPSKSFLKLHSQQGALPCEGQRDV----RVEYIIPNSALGIE 484

  Fly   473 -------YTIVARGNVILSDYVDVP---DG------QKTYTVKFTPTFSMVP--KATIYVYYVVN 519
                   |.:.::|:|..|..|:||   :|      :...::|.|.:..:.|  :|..:: .:.|
 Frog   485 VKHMELHYLVASKGSVKDSGSVEVPITSEGGGSSELRGEVSIKLTLSADVSPTLRALAFI-SLPN 548

  Fly   520 NDLQFEEKTIDFEKEFSNSIDVS-APTNAKPSEEVKLRIKTDADSFVGLLGVDQSVLLLKSGNDL 583
            .:|..:..|...::.|.|.:.|. :|....|..:|.|:::..|.|..||..|||||:|:|...:|
 Frog   549 GELVADSATFKLQRCFKNKVSVGFSPDEVLPGADVSLQVQAAAGSLCGLRVVDQSVVLMKPDKEL 613

  Fly   584 SQDDIFNSLNIYQTSTPWMNGYGRYPGQTSGLVTLTNANYPYNTGPLVMSYVFEGSRHPWITRPR 648
            :.|.|.|....     |...||       ...|..::.:.|:               :||..||.
 Frog   614 TADQIHNLFPF-----PDFGGY-------DARVQDSDDHCPF---------------YPWFHRPM 651

  Fly   649 YRVGI--------RGDSGDRISFLSQSLNDRNLK----------------EILLKQT-------- 681
            ::..|        ..|..|..|.    ..|..||                |..|:..        
 Frog   652 WKRSIVLPPWHMPHEDEVDVYSL----FKDMRLKIVTSAEIKKPLRCREPEFALQYNVLAHPRIA 712

  Fly   682 ----------------------PQRTTIRKEFPETWFF--ENVGEE-EFTLTKKIPDTITSWVVT 721
                                  |....||..|||||.:  |.|||. ...:....|||||.|...
 Frog   713 DAGDGLVRAMPRAVGVGNELTEPAAEIIRAYFPETWIWQLEPVGESGRAEVHGSAPDTITEWNAG 777

  Fly   722 GFSLNPTSGIALTKNPSKIRVFQPFFVSTNLPYSVKRGEVIAIPVVIFNYLDKTLDADVVMDNS- 785
            .|.:.| ||..::. |:.:|.||||||...|||||.|||...:...:||||.:.:.....:..| 
 Frog   778 AFCMGP-SGFGISP-PTSLRAFQPFFVELTLPYSVVRGESFTLKASVFNYLKQCIKVQTTLQPSL 840

  Fly   786 --------DQEYEFTEATNEVLEKAIDEVRRVKRVTIPANSGKSVSFMIRPKNVGFTTLKITATS 842
                    |.:|.                     ..|.|:..|:..:.::..|:|...:.: .|.
 Frog   841 ELEQEPCADCQYS---------------------SCICADESKTFYWNLKASNLGEVNITV-RTE 883

  Fly   843 AL-----------------AGDAIHQKLKVEPEGVTLFENRAVFINLKDQPEMSQSLD--ADIPN 888
            ||                 ..|.:.:.|.|:|.||.:.::.:..|...:..:.|::.|  .::|.
 Frog   884 ALNTQDMCNNEIPIVPKQGHSDTVIKPLLVQPGGVLIEKSHSSLICSPEGEDHSKTEDISLNVPE 948

  Fly   889 EVVPQSEFIEFSVVGDLLGPTLQNLDNLVRMPYGCGEQNMVNFVPNILVLKYLEVTGRKLPSVES 953
            .::..||....:.:|||:|..:||||.|:.|||||||||||.|.|||.:|:|||.|.:..|.:::
 Frog   949 NILEGSERAYVTALGDLMGTAMQNLDRLLAMPYGCGEQNMVLFAPNIFILQYLENTHQLSPEIQT 1013

  Fly   954 KARKFLEIGYQRELTYKHDDGSYSAFGKSDASGSTWLTAYVMRSFHQAGTYTDIDPKVITAGLDF 1018
            ||:.|||.||||:||||.:||||||||..|..|:|||||:|::||.:|..|..||...:.....:
 Frog  1014 KAKGFLESGYQRQLTYKRNDGSYSAFGSRDPEGNTWLTAFVVKSFSKARPYIFIDGDHLNHSFSW 1078

  Fly  1019 LVSKQKESGEFPEVGKLFDNANQ----NPLALTSFVLLAFFE-----NHELIPKYQSAIKKAVRY 1074
            |..|::.||.|..|||||:||.:    :.::|:::|.:|..|     ...::....|.::||.| 
 Frog  1079 LKDKRQRSGCFRSVGKLFNNAMKGGVDDEISLSAYVTIALMEAGLSKEDPMVSDALSCLRKAAR- 1142

  Fly  1075 VAEEADKTDDQYSLAIAAVALQLA---KHPQSEKVIAKLESVARKENDRMWWSKATESTGEDGRV 1136
                  |....|:.|:.|....|:   ||  .||::||||..|.:::.::.|.:...|...|...
 Frog  1143 ------KVSSAYTQALLAYTFTLSDDTKH--REKLLAKLEEKAVRKDGQLHWERKPASKASDLPY 1199

  Fly  1137 FHWKPRSNDVEITSYVLLALL---EKDPAEKALPIIKWLISQRNSNGGFSSTQDTVIGLQALTKF 1198
            ::..| |.:||:|||.|||||   .|| ..||..|:.||..|:|..||||||||||:.||||.|:
 Frog  1200 WYRAP-SAEVELTSYALLALLSGPNKD-LGKASEIVNWLSKQQNPYGGFSSTQDTVVALQALAKY 1262

  Fly  1199 AYKTGSGSGTMDIEFSSAGESKNTIKVNPENSLVLQTHDLPKSTRKVDFTAKGTGSAMVQLSYRY 1263
            |..|.|..|.:.:..:|.........|:..|.|:||...||....:...:|.|:....||...||
 Frog  1263 AEATFSDKGDVTVTVTSKTGFHQQFHVDQTNRLLLQKASLPDIPGEYSLSATGSSCVYVQTVLRY 1327

  Fly  1264 NLAEKEKKPSFKVTPTVKDTPNQL-------LIVDVCAEYVPLEDADKDKDSNMAVMEIALPSGF 1321
            |:.......:|.|  .|:..|.|.       :.:|:..:|.    ..::| ||||::|:.:.|||
 Frog  1328 NIPPPRSDATFSV--RVETQPKQCPQEPMKQMHIDIYIQYT----GSREK-SNMALVEVKMLSGF 1385

  Fly  1322 VGDSTSLGKIQAVDRVKRVETKNSDSTVV--------VYFDSLTPGDVRCLPLEASKAHAVAKQK 1378
            :...:::.::.:.:.:||.|.:....|:.        |:|..:...|:.           |...|
 Frog  1386 IPVKSTIKQLVSSNTIKRSEIQTDMVTLYLNELGHDPVHFSIMVEQDIE-----------VKNLK 1439

  Fly  1379 PASVSLYDYYDT-ERKATEYYQVKSS 1403
            ||:|.:||||:| |...|||....||
 Frog  1440 PATVKVYDYYETAEHAVTEYNSPCSS 1465

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Tep2NP_523506.1 A2M_N 115..209 CDD:280081 43/95 (45%)
A2M_N_2 445..576 CDD:285005 35/158 (22%)
A2M 694..782 CDD:278630 36/91 (40%)
A2M_2 909..1198 CDD:239227 134/304 (44%)
A2M_comp 961..1199 CDD:284982 103/253 (41%)
A2M_recep 1308..1398 CDD:284981 29/99 (29%)
a2ml1XP_012809688.1 A2M_N 124..225 CDD:280081 52/108 (48%)
Big_3_4 <359..>403 CDD:304928 11/52 (21%)
A2M_N_2 489..604 CDD:285005 30/116 (26%)
A2M 747..836 CDD:278630 36/91 (40%)
SVA <798..893 CDD:283081 28/117 (24%)
A2M_2 969..1262 CDD:239227 134/304 (44%)
A2M_comp 1021..1264 CDD:284982 104/254 (41%)
A2M_recep 1372..1459 CDD:284981 28/98 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C119861823
eggNOG 1 0.900 E1_COG2373
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D177369at33208
OrthoFinder 1 1.000 FOG0000048
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.