DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG7025 and CG17633

Sequence 1:NP_609133.2 Gene:CG7025 FlyBaseID:FBgn0031930 Length:429 Species:Drosophila melanogaster
Sequence 2:NP_609310.2 Gene:CG17633 FlyBaseID:FBgn0032144 Length:430 Species:Drosophila melanogaster

Alignment Length:435 Identity:167/436 (38%)
Similarity:247/436 (57%) Gaps:20/436 (5%)


  Fly     1 MALNSLPIVLALVVLAQGASFGQDERLRYDNYSVYKVKFETQAQRSILRKLAEDRENFRLW---H 62
            |:||.. ::.||:.:...||... ||:|||||.:|||..|...|..:|:.|....::....   |
  Fly     1 MSLNKC-LLFALLAIVASASVSA-ERVRYDNYRMYKVNSENAKQLEVLKDLEGSSDSIMFLDGVH 63

  Fly    63 EAKDELHLMLSPGAFGELETEIQKTNVTAELFISNVQELIDS-EEAANLKASRDGTFGWTKYNSL 126
            ....::.::::|....:....:.|:.:..||...:||:.:|. :|...:|......:.|.:|..|
  Fly    64 LVGADIQIIVAPHKVPDFLEILGKSEIKYELQSRDVQKSLDEIDEKVAIKGRATTAYNWAQYYEL 128

  Fly   127 AEIYAWLDDILAAYPTITESFIVGQSYEGRTIRGIKISYKSN------NPGVLIESNIHAREWIT 185
            .:.||||..:....|.:......|::|:||:|.|:||:....      .||:.:|:.|||||||.
  Fly   129 DDTYAWLQSLAQTNPGVVTLIEGGKTYQGRSILGVKITKGGETINGKAKPGIFLEAGIHAREWIA 193

  Fly   186 SATATWLINEFLTSTDELVRDLAENHDWYIVPVLNVDGFVYTHEKDRMWRKTRQPSEISSCIGAD 250
            .|.||::||:.|||..|.:::||||:.||::|..|.||:||||..:|:|||||.|  ..||.|||
  Fly   194 PAAATFIINQLLTSEVENIKELAENYTWYVLPHANPDGYVYTHTTNRLWRKTRTP--YGSCFGAD 256

  Fly   251 PNRNYDSHWMENEGASSNPCAEDYGGPKPFSEPEIQAMSEFVISIKDKINVLLAFHSYSQLLLSP 315
            ||||:..||.| .||||:.|::.|.||..|||.|..::|:|:..:|.|:.:.|:.|:|||.||.|
  Fly   257 PNRNWGFHWNE-VGASSSACSDTYAGPSAFSEIETLSLSKFIEGLKGKVQLYLSLHAYSQYLLYP 320

  Fly   316 YGHTKEEFPPNFDDMMEVAKAYGDAVESLPYGTVYRYGSAAGILYPASGATIDWAYNEQGVEISY 380
            |||| .:.|.|..|..:|..|...||.. .|||.|..|:....:|||:||::||||..|.|.:::
  Fly   321 YGHT-SDLPDNVADFEKVFDASIAAVNK-RYGTTYTGGNIYDAIYPAAGASVDWAYGTQDVRMAF 383

  Fly   381 TIEFRDTGR---YGFILPPVHIIPNAEEALIGIAALLEKCKDLGY 422
            ..|.|.:..   .||.||...|:|.:||.|..|.|:..:.|.|||
  Fly   384 CYELRPSSTSYLTGFKLPAEQIVPASEELLDSIVAMATEVKSLGY 428

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG7025NP_609133.2 Propep_M14 36..103 CDD:280416 13/70 (19%)
M14_CP_A-B_like 123..416 CDD:199844 131/302 (43%)
CG17633NP_609310.2 MpaA 7..374 CDD:225421 144/373 (39%)
Propep_M14 34..105 CDD:280416 14/71 (20%)
M14_CP_A-B_like 125..423 CDD:199844 131/303 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C71061389
eggNOG 1 0.900 E1_COG2866
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 66 1.000 Inparanoid score I2432
Isobase 1 0.950 0 Normalized mean entropy S1851
OrthoDB 1 1.010 D208397at33208
OrthoFinder 1 1.000 FOG0000073
orthoMCL 1 0.900 OOG5_132369
Panther 1 1.100 P PTHR11705
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1730
98.870

Return to query results.
Submit another query.