DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG18585 and Cpb2

Sequence 1:NP_001260213.1 Gene:CG18585 FlyBaseID:FBgn0031929 Length:422 Species:Drosophila melanogaster
Sequence 2:NP_062749.2 Gene:Cpb2 MGIID:1891837 Length:422 Species:Mus musculus

Alignment Length:384 Identity:138/385 (36%)
Similarity:224/385 (58%) Gaps:22/385 (6%)


  Fly    46 IEKIGELTKKYNI--WK----EYDERSRQIDIMVSPGELNHFQELLKFNNISSELMIENVQERID 104
            ::.:..||..|.:  |:    |:.|:.:::...|:..:::..:..|..:.|...:::.||::.|:
Mouse    38 VQLLQNLTTTYEVVLWQPVTAEFIEKKKEVHFFVNASDVDSVKAHLNVSRIPFNVLMNNVEDLIE 102

  Fly   105 E----EQVTPTADSATFGWTKYYELEEIEAWLDEILNAYPSVTEEFIVGKSYEGRTIRGIKISHK 165
            :    :.|:|.| ||:: :.:|:.|.||.:|::.|...:|.:.::..:|.|:|...:..:|:|.|
Mouse   103 Q
QTFNDTVSPRA-SASY-YEQYHSLNEIYSWIEVITEQHPDMLQKIYIGSSFEKYPLYVLKVSGK 165

  Fly   166 AG--NPGIFIESNIHAREWITSASATWFI---NQLLTSEDADVRSLADNYDWHIIPVFNVDGFEY 225
            ..  ...|:|:..|||||||:.|...|||   .|....|:...| |..:.|::|:||.||||::|
Mouse   166 EQRIKNAIWIDCGIHAREWISPAFCLWFIGYVTQFHGKENLYTR-LLRHVDFYIMPVMNVDGYDY 229

  Fly   226 SHKKDRMWRKTRQPHATNACIGADANRNFDS-YWLQNNGASDNPCSETFAGDNPESEPEAKALVE 289
            :.||:|||||.|..|..|.|:|.|.||||.| :|.: .|||.:.||||:.|..||||||.||:.:
Mouse   230 TWKKNRMWRKNRSAHKNNRCVGTDLNRNFASKHWCE-KGASSSSCSETYCGLYPESEPEVKAVAD 293

  Fly   290 YLTKIQDQISVYISFHSYGQYLLSPYGHTNEEFPENYNDILTIGKAFADAIEALPYGTVYQYGST 354
            :|.:..|.|..|||.|||.|.:|.||.: |....:::.::..:......|||::...|.|.:||.
Mouse   294 FLRRNIDHIKAYISMHSYSQQILFPYSY-NRSKSKDHEELSLVASEAVRAIESINKNTRYTHGSG 357

  Fly   355 ADVLYVATGTSVDWVFNELGKKIGYTIEYRDKGRYGFILPPVQIIPNCEELMVGMLALI 413
            ::.||:|.|.|.||:: :||.|..:|||.||.|||||:||...|.|.|.|.:..:..::
Mouse   358 SESLYLAPGGSDDWIY-DLGIKYSFTIELRDTGRYGFLLPERYIKPTCAEALAAISKIV 415

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG18585NP_001260213.1 Propep_M14 34..105 CDD:280416 12/65 (18%)
M14_CP_A-B_like 122..415 CDD:199844 121/299 (40%)
Cpb2NP_062749.2 Propep_M14 32..103 CDD:280416 12/65 (18%)
M14_CPB2 118..419 CDD:199868 121/304 (40%)
Substrate binding. {ECO:0000250|UniProtKB:P00730} 180..183 3/3 (100%)
Substrate binding. {ECO:0000250|UniProtKB:P00730} 255..256 1/1 (100%)
Substrate binding. {ECO:0000250|UniProtKB:P00730} 310..311 1/1 (100%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C70869870
eggNOG 1 0.900 E1_COG2866
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 267 1.000 Inparanoid score I3000
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D208397at33208
OrthoFinder 1 1.000 FOG0000073
OrthoInspector 1 1.000 T130950
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11705
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1730
TreeFam 00.000 Not matched by this tool.
99.020

Return to query results.
Submit another query.