DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG18585 and CG2915

Sequence 1:NP_001260213.1 Gene:CG18585 FlyBaseID:FBgn0031929 Length:422 Species:Drosophila melanogaster
Sequence 2:NP_610338.1 Gene:CG2915 FlyBaseID:FBgn0033241 Length:453 Species:Drosophila melanogaster

Alignment Length:440 Identity:159/441 (36%)
Similarity:242/441 (55%) Gaps:28/441 (6%)


  Fly     5 WLLATLVALTSAGILKDS----------------PKERYDNFRVYKLTIQNKIQLAAIEKIGELT 53
            ||:...||:.::|...||                .:.||||:|:|.:..:|:.|:...:|:.|.:
  Fly    17 WLVILCVAMAASGTNLDSGICPVAGDSGCRGNPPDQARYDNYRIYNVEFENQEQIELFQKLEEQS 81

  Fly    54 KKYNIWKEYDERSRQIDIMVSPGELNHFQELLKFNNISSELMIENVQERIDEE--QVTP-TADSA 115
            ..........|..:::.|:|:...:....:|||...:...::..|.||:||..  :|.| :.|::
  Fly    82 DSLTFIGHAREVGQKLSILVAAHRVADIADLLKTYKVKHRVLTYNFQEKIDRNLAEVQPESIDAS 146

  Fly   116 TFGWTKYYELEEIEAWLDEILNAYPSVTEEFIVGKSYEGRTIRGIKISHKAGNPGIFIESNIHAR 180
            ...|..::.|:.|..|||:::..||:......:|.|.:|..|:|:|::..|.|..|||||.||||
  Fly   147 QLDWQHFFHLKTIYEWLDKMVEKYPNRVTVLDMGSSTQGNAIKGVKLTSNANNKAIFIESGIHAR 211

  Fly   181 EWITSASATWFINQLLTSEDADVRSLADNYDWHIIPVFNVDGFEYSHKKDRMWRKTRQPHATNAC 245
            |||:.|:||:.|||||||:|..|:.||.:|:|.|.|..|.||::|:.:.||||||.||...|  |
  Fly   212 EWISPAAATYIINQLLTSQDPKVQQLAQDYNWIIFPCVNPDGYKYTFEHDRMWRKNRQLFGT--C 274

  Fly   246 IGADANRNFDSYWLQNNGASDNPCSETFAGDNPESEPEAKALVEYL--TKIQDQISVYISFHSYG 308
            .|.|.|||:..:| .:.|:|.:|....|||.:..||.|.|.|::::  ...::||..||:.|||.
  Fly   275 RGVDLNRNYPDHW-NSTGSSSDPTRYDFAGPSAGSELETKRLIDFIRANAGKEQIKTYIALHSYS 338

  Fly   309 QYLLSPYGHTNEEFPENYNDILTIGKAFADAIEALPYGTVYQYGSTADVLYVATGTSVDWVFNEL 373
            |.|:.|||:|.|.. .||:|:...||..:.||:| ..|..|..||..:.:|.::|.|:||..:|.
  Fly   339 QMLMFPYGYTKERV-SNYDDLQEFGKKASAAIKA-ENGRDYVSGSLFETIYPSSGGSMDWAHSEA 401

  Fly   374 GKKIGYTIEYR--DKGRYGFILPPVQIIPNCEELMVGMLALIEKTKELGY 421
            |..|.||.|.|  ...:..||||.|:|.|...|....:.|::|...|.||
  Fly   402 GIPIAYTFELRGPPDSQDLFILPAVEIQPTASEAFTAIRAIVEAAAEKGY 451

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG18585NP_001260213.1 Propep_M14 34..105 CDD:280416 15/71 (21%)
M14_CP_A-B_like 122..415 CDD:199844 124/297 (42%)
CG2915NP_610338.1 MpaA 50..433 CDD:225421 146/388 (38%)
Propep_M14 63..133 CDD:280416 15/70 (21%)
M14_CP_A-B_like 153..446 CDD:199844 124/298 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C71041265
eggNOG 1 0.900 E1_COG2866
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 66 1.000 Inparanoid score I2432
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D208397at33208
OrthoFinder 1 1.000 FOG0000073
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR11705
RoundUp 00.000 Not matched by this tool.
65.990

Return to query results.
Submit another query.