DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG18585 and cpa5

Sequence 1:NP_001260213.1 Gene:CG18585 FlyBaseID:FBgn0031929 Length:422 Species:Drosophila melanogaster
Sequence 2:NP_954965.1 Gene:cpa5 ZFINID:ZDB-GENE-020514-1 Length:419 Species:Danio rerio

Alignment Length:435 Identity:155/436 (36%)
Similarity:255/436 (58%) Gaps:33/436 (8%)


  Fly     2 RLLWLLATLVALTSAGILKDSPKERYDNFRVYKLTIQNKIQLAAIEKIGELTKK-----YNIWKE 61
            |||.|:|..||:..        |:.::..:|:::|.:::.|   |:.:.|||::     .::|.|
Zfish     3 RLLVLIALFVAVFG--------KKTFEGDQVFRITPKDEAQ---IDLLKELTEEGEHLGLSVWME 56

  Fly    62 YDERSRQIDIMVSPGELNHFQELLKFNNISSELMIENVQERIDEEQ--------VTPTADSATFG 118
            ....|..:|:.|....|...:..|.:|.|...:|||||||.:|:||        :..:.|.  |.
Zfish    57 PILESLPLDLHVPFHSLQAVRAFLAYNQIPYHIMIENVQELLDDEQRDMVKYRGLARSTDD--FV 119

  Fly   119 WTKYYELEEIEAWLDEILNAYPSVTEEFIVGKSYEGRTIRGIKISHKAGNPGIFIESNIHAREWI 183
            :|.|::|..|.:::|.::....::..:.::|:|||.|.:..:|.|..|..|||:|::.||:|||:
Zfish   120 YTTYHDLNSINSFMDMLVAENRNMVSKVVIGQSYEKRPLNVLKFSTGANRPGIWIDTGIHSREWV 184

  Fly   184 TSASATWFINQLLT--SEDADVRSLADNYDWHIIPVFNVDGFEYSHKKDRMWRKTRQPHATNACI 246
            |.||..||..:::.  ..|..:..:.:::|..:..|.|.|||.|:|.|||||||||:|:..::|:
Zfish   185 TQASGVWFAKKIVKDYGRDPVLTDILNSHDIFLEIVTNPDGFVYTHTKDRMWRKTRKPNPGSSCV 249

  Fly   247 GADANRNFDSYWLQNNGASDNPCSETFAGDNPESEPEAKALVEYLTKIQDQISVYISFHSYGQYL 311
            |.|.|||:|: .....|:|:|||:||:.|.:..||||.||:|::: |...:|..::|.|||.|.|
Zfish   250 GVDPNRNWDA-GFGGGGSSNNPCTETYRGPSAHSEPEVKAIVDFV-KSHGKIKAFVSIHSYSQML 312

  Fly   312 LSPYGHTNEEFPENYNDILTIGKAFADAIEALPYGTVYQYGSTADVLYVATGTSVDWVFNELGKK 376
            |.|||:|... .::..::..:.:....::::| |.|.|.|||....:|.|:|.::||.:|: |.|
Zfish   313 LYPYGYTYTA-AKDKAELHEVARKAITSLQSL-YNTRYTYGSIITTIYQASGGTIDWTYNQ-GIK 374

  Fly   377 IGYTIEYRDKGRYGFILPPVQIIPNCEELMVGMLALIEKTKELGY 421
            ..||.|.||.||||||||..||:|..||..:.::|::|.||...|
Zfish   375 YSYTFELRDTGRYGFILPANQIVPTAEETWLALMAIMEHTKNNPY 419

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG18585NP_001260213.1 Propep_M14 34..105 CDD:280416 23/76 (30%)
M14_CP_A-B_like 122..415 CDD:199844 115/295 (39%)
cpa5NP_954965.1 Propep_M14 27..100 CDD:280416 23/76 (30%)
Peptidase_M14_like 118..417 CDD:299699 119/304 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C69773926
eggNOG 1 0.900 E1_COG2866
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 287 1.000 Inparanoid score I2755
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D208397at33208
OrthoFinder 1 1.000 FOG0000073
OrthoInspector 1 1.000 T128794
orthoMCL 1 0.900 OOG5_132369
Panther 1 1.100 O PTHR11705
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1730
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
109.920

Return to query results.
Submit another query.