DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG18585 and Y59C2A.1

Sequence 1:NP_001260213.1 Gene:CG18585 FlyBaseID:FBgn0031929 Length:422 Species:Drosophila melanogaster
Sequence 2:NP_494213.2 Gene:Y59C2A.1 WormBaseID:WBGene00021984 Length:454 Species:Caenorhabditis elegans

Alignment Length:457 Identity:147/458 (32%)
Similarity:230/458 (50%) Gaps:61/458 (13%)


  Fly     4 LW---LLATLVALTSAGI--LKDSPKER--YDNFRVYKLTIQNKIQLAAIEKIG----ELTKK-- 55
            :|   |:..|:.:|:.|:  .::|.::|  |..:.:::..:.....  .:||:.    :|.|.  
 Worm     1 MWSHTLVPILILVTTYGVNCHENSGEKRADYSGYTLHRFKVDTSSD--TMEKLEGYDMQLDKTTQ 63

  Fly    56 -----YNIWKEYDERSRQIDIMVSPGELNHFQELLKFNNISSELMIE-NVQERIDEEQVTPTADS 114
                 .:||.|..:::...||:|:|..|..|:.||....:|:..|:| ::|.:|:.|:.....:|
 Worm    64 TARLLIDIWAEPSKQNPYADILVAPEFLQKFKSLLTSAELSTLKMLEGDIQSQINAERHAMIRNS 128

  Fly   115 ATFGWTKYYELEEIEAWLDEILNAYPSVTE--EFI---------------VGKSYEGRTIRGIKI 162
            ..      .....::.|.:...|||.|..|  ||:               |..|.|||:|.|:||
 Worm   129 VR------RRKRAMKTWQEFDTNAYHSYNEMVEFMKLLSEQKSDMVEMVKVATSSEGRSIYGVKI 187

  Fly   163 SHKAG-----NPGIFIESNIHAREWITSASATWFINQLLT--SEDADVRSLADNYDWHIIPVFNV 220
             |..|     .|.|.:::.:||||||..|...:.|.:::.  ..:..|.:....:||:|:|..|.
 Worm   188 -HPPGPSPPEKPSIIVDAGVHAREWIAPAVGLFMIRKIVEEYGRNPQVTANLQKFDWYIMPQVNP 251

  Fly   221 DGFEYSHKKDRMWRKTRQPHAT--NACIGADANRNFDSYWLQNNGASDNPCSETFAGDNPESEPE 283
            ||:|||...||:|||||..:.|  ..|:|||||||:...| ...||:..|||..:.|.:|.||||
 Worm   252 DGYEYSRTTDRLWRKTRSKNVTVNRWCVGADANRNWGYRW-GEAGANRTPCSNIYMGSHPYSEPE 315

  Fly   284 AKALVEYLTKIQDQISVYISFHSYGQYLLSPYGHTNEEFPENYNDILTIGKAFADAIEALPYGTV 348
            .:.|.|:.|.......||||.|||||.||||:|:|||. .|||.|.....|..|.||:... |..
 Worm   316 IRGLKEFFTWQITNPMVYISLHSYGQLLLSPWGYTNER-TENYQDQQNAAKEAAQAIKNTT-GVS 378

  Fly   349 YQYGSTADVLYVATGTSVDWVFNELGKKIGYTIEYR---DKGRYGFILPPVQIIPNCEELMVGML 410
            |.||:.::::|.|:|||:|:: ...|....|.:|.|   :...:.|.|||..|....:|::..:.
 Worm   379 YSYGTISEMMYPASGTSIDFM-QHRGVPYIYGVELRPTDNPNSFAFNLPPSYIRATGDEMLAALN 442

  Fly   411 AL 412
            |:
 Worm   443 AI 444

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG18585NP_001260213.1 Propep_M14 34..105 CDD:280416 20/83 (24%)
M14_CP_A-B_like 122..415 CDD:199844 117/321 (36%)
Y59C2A.1NP_494213.2 Propep_M14 <69..119 CDD:280416 16/50 (32%)
M14_CP_A-B_like 147..448 CDD:199844 114/304 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG2866
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D208397at33208
OrthoFinder 1 1.000 FOG0000073
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.