DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG18585 and cpo

Sequence 1:NP_001260213.1 Gene:CG18585 FlyBaseID:FBgn0031929 Length:422 Species:Drosophila melanogaster
Sequence 2:NP_001139101.1 Gene:cpo ZFINID:ZDB-GENE-070619-6 Length:363 Species:Danio rerio

Alignment Length:332 Identity:125/333 (38%)
Similarity:198/333 (59%) Gaps:14/333 (4%)


  Fly    89 NISSELMIENVQERIDEEQVTPTADSATFGWTKYYELEEIEAWLDEILNAYPSVTEEFIVGKSYE 153
            :|:|.|::..:   :.::::....:..::.:|||:.::||.||::::....|.|......|::||
Zfish     5 SITSILVVLTL---VAQDRLAGGLEHKSYDYTKYHTMDEISAWMNQMQRENPDVVSTMTYGQTYE 66

  Fly   154 GRTIRGIKISHKAGNP--GIFIESNIHAREWITSASATWFINQLLTS--EDADVRSLADNYDWHI 214
            .|.|..:||...:..|  .|:::..|||||||..|....|:.::|.|  .|:.|..|..|.|::|
Zfish    67 KRNITLLKIGFSSTTPKKAIWMDCGIHAREWIAPAFCQHFVKEVLGSYKTDSRVNMLFKNLDFYI 131

  Fly   215 IPVFNVDGFEYS--HKKDRMWRKTRQP-HATNACIGADANRNFDSYWLQNNGASDNPCSETFAGD 276
            .||.|:||:.||  :...|:|||:|.| |..:.|.|.|.||||.:.| ...|.|.|.|||.:.|.
Zfish   132 TPVLNMDGYIYSWLNNSTRLWRKSRSPCHENSTCSGTDLNRNFYANW-GMVGISRNCCSEVYNGA 195

  Fly   277 NPESEPEAKALVEYLTKIQDQISVYISFHSYGQYLLSPYGHTNEEFPENYNDILTIGKAFADAIE 341
            ...|||||:|:.::|...|:.:..|::.|||||.:|.||||.|...| ||::::.:|.|.|.||:
Zfish   196 TALSEPEAEAVTDFLGAHQNHLLCYLTIHSYGQLILVPYGHPNISAP-NYDELMEVGLAAAKAIK 259

  Fly   342 ALPYGTVYQYGSTADVLYVATGTSVDWVFNELGKKIGYTIEYRDKGRYGFILPPVQIIPNCEELM 406
            |: :|..|:.||:.||||..:|:|.|:. ..:|....:|.|.||:|::|||||..||.|.|:|..
Zfish   260 AV-HGKSYKVGSSPDVLYPNSGSSRDFA-RLIGIPYSFTFELRDEGQHGFILPEDQIQPTCQEAY 322

  Fly   407 VGMLALI 413
            .|.:::|
Zfish   323 EGAMSII 329

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG18585NP_001260213.1 Propep_M14 34..105 CDD:280416 3/16 (19%)
M14_CP_A-B_like 122..415 CDD:199844 120/300 (40%)
cpoNP_001139101.1 M14_CP_A-B_like 35..332 CDD:199844 120/300 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C70514293
eggNOG 1 0.900 E1_COG2866
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D208397at33208
OrthoFinder 1 1.000 FOG0000073
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11705
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1730
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
76.970

Return to query results.
Submit another query.