DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: santa-maria and SCARB1

Sequence 1:NP_609121.2 Gene:santa-maria FlyBaseID:FBgn0025697 Length:563 Species:Drosophila melanogaster
Sequence 2:NP_001354910.1 Gene:SCARB1 HGNCID:1664 Length:552 Species:Homo sapiens

Alignment Length:548 Identity:155/549 (28%)
Similarity:261/549 (48%) Gaps:49/549 (9%)


  Fly    26 LGLFGILCGMFWV-------DLFDWIMHKEMALAPDTRVYENWKSPPIDLSLDIYLYNWTNPEDF 83
            ||:.|:||.:...       .|....:.|.:.:.|.:..:..||..||...|.:|.::..||.:.
Human    14 LGVAGLLCAVLGAVMIVMVPSLIKQQVLKNVRIDPSSLSFNMWKEIPIPFYLSVYFFDVMNPSEI 78

  Fly    84 GNLSTKPILEQVGPYRFIERPDKVDIHWHPENASVTYRRRSLFYFDAAGSNGSLDDEITTLNAVA 148
            .. ..||.:.:.|||.:.|...|.:|.:: .|.:|::.....|.|..:.|:||..|.|...|.:.
Human    79 LK-GEKPQVRERGPYVYREFRHKSNITFN-NNDTVSFLEYRTFQFQPSKSHGSESDYIVMPNILV 141

  Fly   149 LSAAATAKYWPPVKRSLVDVGLKMYGAEMSVQKSIDELLFTGYNDAMID-VAMAMP-IFGDEVKV 211
            |.||...:..|...:.::.:.....|....:.:::.|::: ||.|.::: :....| :|      
Human   142 LGAAVMMENKPMTLKLIMTLAFTTLGERAFMNRTVGEIMW-GYKDPLVNLINKYFPGMF------ 199

  Fly   212 PF-DKFGWFYTRNGSADLTGVFNVFTGADQLAKLGQMHSWNYQENTGFFDS-YCGMTNGSAGEFQ 274
            || ||||.|...|.|.  :|:|.||||...::::..:..||......|:.| .|.|.||::|:..
Human   200 PFKDKFGLFAELNNSD--SGLFTVFTGVQNISRIHLVDKWNGLSKVDFWHSDQCNMINGTSGQMW 262

  Fly   275 PQHLKPGDSVGLFTPDMCRTIPLDYVETVDIEGLEGYKFSGGPRSVDNGTQYPENLCFCGGQCVP 339
            |..:.|..|:..::|:.||::.|.|.|:...||:..|:|........||:.||.|..||  .|:.
Human   263 PPFMTPESSLEFYSPEACRSMKLMYKESGVFEGIPTYRFVAPKTLFANGSIYPPNEGFC--PCLE 325

  Fly   340 SGVMNISSCRFGSPVFMSYPHFFNADPYYPDQVEGLSPNQKDHEFYMVVQPSTGIPLEVAARFQV 404
            ||:.|:|:|||.:|:|:|:|||.||||...:.|.||.|||:.|..::.:.|.||||:..:.:.|:
Human   326 SGIQNVSTCRFSAPLFLSHPHFLNADPVLAEAVTGLHPNQEAHSLFLDIHPVTGIPMNCSVKLQL 390

  Fly   405 NMLVEPIQGISLYTGIPRIFFPLVWFEQKVRITPD----MADQLKVLPIVMLSGHIFAGICLIVG 465
            ::.::.:.||.....|..:..||:||.:...:..:    ...||.::|.||   |....:.|.:|
Human   391 SLYMKSVAGIGQTGKIEPVVLPLLWFAESGAMEGETLHTFYTQLVLMPKVM---HYAQYVLLALG 452

  Fly   466 ITLLCWTPVQILLASCRNRRYDLRTKTKTNGQYKSRSQFSSAEELKSKASTLVCEKSVKGSPDSS 530
            ..||. .||     .|:     :|::... ||..:|:...|.......||......:...||..:
Human   453 CVLLL-VPV-----ICQ-----IRSQVGA-GQRAARADSHSLACWGKGASDRTLWPTAAWSPPPA 505

  Fly   531 PLLEKGRKPTIIKSQTGESVATASTAIS 558
            .:|.      :.:|.:|......||..|
Human   506 AVLR------LCRSGSGHCWGLRSTLAS 527

Known Domains:


GeneSequenceDomainRegion External IDIdentity
santa-mariaNP_609121.2 CD36 23..474 CDD:279474 138/463 (30%)
SCARB1NP_001354910.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3776
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1106566at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11923
Phylome 1 0.910 0.609 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.920

Return to query results.
Submit another query.