DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: santa-maria and scarb2b

Sequence 1:NP_609121.2 Gene:santa-maria FlyBaseID:FBgn0025697 Length:563 Species:Drosophila melanogaster
Sequence 2:XP_009299911.1 Gene:scarb2b ZFINID:ZDB-GENE-170406-1 Length:523 Species:Danio rerio

Alignment Length:530 Identity:156/531 (29%)
Similarity:264/531 (50%) Gaps:42/531 (8%)


  Fly    20 GIFGFCLGLFGILCGMFWVDLFDWIMH----KEMALAPDTRVYENWKSPPIDLSLDIYLYNWTNP 80
            |..|..|.|.||  .:|...||..::|    ||:.|...::|:..||:||..:.::.:.:|.|||
Zfish    12 GAAGALLLLAGI--ALFASGLFQTLIHNKLKKEITLTEGSKVFATWKNPPPPVYMEFFFFNVTNP 74

  Fly    81 EDFGNLSTKPILEQVGPYRFIERPDKVDIHWHPENASVTYRRRSLFYFDAAGSNGSLD-DEITTL 144
            |.|.....|..|.::|||.:.|...|.::.:......|......:|.|....|.|... |.:||:
Zfish    75 EAFLKGEAKARLSEMGPYTYREYRPKHNVSFVDNGTKVAAYTPKVFVFVPEKSVGDPSVDMVTTV 139

  Fly   145 NAVALSAAATAKYWPPVKRSLVDVGLKMYGAEMSVQKSIDELLFTGYNDAMIDVAMAMPIFGDEV 209
            |..|::.....|....:..|.:.:.:|..||||.:..::||||: |:.|.::....::....||.
Zfish   140 NIPAVAVMNRIKGAGFLVSSAMSLYMKSIGAEMFMTHTVDELLW-GFKDPLLTKLRSIKPETDEF 203

  Fly   210 KVPFDKFGWFYTRNGSADLTGVFNVFTGADQLAKLGQMHSWNYQENTGFF-DSYCGMTNGSAGE- 272
                  ||....:|||.|  |.|...||.......|::.:|..::...|: .:...|.||:.|. 
Zfish   204 ------FGLMLHKNGSDD--GEFVYHTGEHNYLDYGRIFTWKGEKLMSFWKTNQSNMINGTDGSA 260

  Fly   273 FQPQHLKPGDSVGLFTPDMCRTIPLDYVETVDIEGLEGYKFSGGPRSV-DNGTQYPENLCFC--G 334
            |.| .|...:.:.:||.|:||:|.:.:.:.|:::|:..|:|: .||:| .:||..|||..||  .
Zfish   261 FHP-FLTKEERLDVFTADLCRSIHMRFEKEVEVKGIPAYRFT-PPRAVLASGTNNPENEGFCLTP 323

  Fly   335 GQCVPSGVMNISSCRFGSPVFMSYPHFFNADPYYPDQVEGLSPNQKDHEFYMVVQPSTGIPLEVA 399
            .:|:..||:::|.||.|:||.:|:|||...|..|...||||||..:.|:.::.:.|:.|:|:...
Zfish   324 KKCLDDGVLDVSVCRQGAPVVVSFPHFHLGDEKYVQAVEGLSPVHEQHQTFLDLNPTMGVPVRAM 388

  Fly   400 ARFQVNMLVEPIQGISLYTGIPRIFFPLVWFEQKVRITPDMADQL-KVLPIVMLSGHIFAGICLI 463
            .|.|:|:.:|.:.|..:...:....||:::..:.|.|....|::: |:|.:|.|..| |..|.:.
Zfish   389 KRAQINIHLERVTGFPMTRNLESTIFPIIFLNESVVIDNASAERIQKLLLVVTLVSH-FPLILVA 452

  Fly   464 VGITLLCWTPVQILLASCRNRRYDLRTKTKTNGQYKSRSQFSSAEELKSKASTLVCEKSVKGSPD 528
            :|:.||.   |.::||.   |.|..:|:.|         :|..||.....|.:  .:|....:|.
Zfish   453 LGVILLI---VAVILAV---RYYQNKTEVK---------RFDFAEAFHCTAPS--AKKDTSYAPV 500

  Fly   529 SSPLLEKGRK 538
            |:.:.::..|
Zfish   501 SAKVDDQDEK 510

Known Domains:


GeneSequenceDomainRegion External IDIdentity
santa-mariaNP_609121.2 CD36 23..474 CDD:279474 140/462 (30%)
scarb2bXP_009299911.1 CD36 30..463 CDD:279474 135/448 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3776
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1106566at2759
OrthoFinder 1 1.000 FOG0000266
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11923
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
44.010

Return to query results.
Submit another query.