DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: santa-maria and RGD1565355

Sequence 1:NP_609121.2 Gene:santa-maria FlyBaseID:FBgn0025697 Length:563 Species:Drosophila melanogaster
Sequence 2:NP_001102688.1 Gene:RGD1565355 RGDID:1565355 Length:472 Species:Rattus norvegicus

Alignment Length:490 Identity:133/491 (27%)
Similarity:241/491 (49%) Gaps:45/491 (9%)


  Fly    14 NRKLIIG-IFGFCLGLFGILCGMFWVDLFDWIMHKEMALAPDTRVYENWKSPPIDLSLDIYLYNW 77
            |..||.| |.|..|.:||.:.......|.:..:.:|:.|...|..::||......:....::::.
  Rat     6 NCGLITGAIIGAVLAVFGGILMPVGDLLIEKTIKREVVLEEGTIAFKNWVKTGTTVYRQFWIFDV 70

  Fly    78 TNPEDFGNLSTKPILEQVGPYRF-IERPDKVDIHWHPENASVTYRRRSLFYFDAAGSNGSLDDEI 141
            .|||:....|:|..::|.|||.: :....|.:|...|::::|::.:.:...|:.:.|.|:.:|..
  Rat    71 QNPEEVAKNSSKIKVKQRGPYTYRVRYLAKENITQDPKDSTVSFVQPNGAIFEPSLSVGTENDNF 135

  Fly   142 TTLNAVALSAAATAKYWPPVKRSLVDVGLKMYGAEMSVQKSIDELLFTGYNDAMIDVAMAMPIFG 206
            |..|...  |||...|.....:.:::..:|...:.|...:|:.|||: ||.|..:.:        
  Rat   136 TVPNLAV--AAAPHIYQNSFIQGVLNNLIKKSKSSMFQTRSLKELLW-GYKDPFLSL-------- 189

  Fly   207 DEVKVPF---DKFGWFYTRNGSADLTGVFNVFTGADQLAKLGQMHSWNYQENTGFFDSYCGMTNG 268
                :|:   ...|.||..|.:.|  ||:.||.|.|.:.|:..:.::..:.|..::.|||.|.||
  Rat   190 ----IPYPISTTVGVFYPYNNTVD--GVYKVFNGKDNINKVAIIDTYKGKRNLSYWKSYCDMING 248

  Fly   269 SAGEFQPQHLKPGDSVGLFTPDMCRTIPLDYVETVDIEGLEGYKFSGGPRSVDNGTQYPENLCFC 333
            :.....|..::...::..|:||:||:|...:...|:::|:..|:|.....:..:..|.|:|.|||
  Rat   249 TDAASFPPFVEKSRTLRFFSPDICRSIYAVFESEVNLKGIPVYRFVLPVNAFASPLQNPDNHCFC 313

  Fly   334 -----GGQCVPSGVMNISSCRFGSPVFMSYPHFFNADPYYPDQVEGLSPNQKDHEFYMVVQPSTG 393
                 ...|...||::|..|:.|.||::|.|||.:|.|...:.::||:||:.:|..|:.|:|.||
  Rat   314 TEKVISNNCTSYGVLDIGKCKEGKPVYISLPHFLHASPDVSEPIQGLNPNEDEHRTYLDVEPITG 378

  Fly   394 IPLEVAARFQVNMLVEPIQGISLYTGIPRIFF-PLVWF-------EQKVRI-TPDMADQLKVLPI 449
            ..|:.|.|.|||:||:|.:.|.....:.|.:. |::|.       ::||.| ...:..::.:|.:
  Rat   379 FTLQFAKRLQVNILVKPARKIEALRNLKRPYIVPILWLNETGTIGDEKVEIFRNQVTGKINLLDL 443

  Fly   450 VMLSGHIFAGICLIVGITLLCWTPVQILLASCRNR 484
            |       ..:.|:||:  |.:....|...:||::
  Rat   444 V-------ERVLLVVGV--LMFVAFMISYCACRSK 469

Known Domains:


GeneSequenceDomainRegion External IDIdentity
santa-mariaNP_609121.2 CD36 23..474 CDD:279474 125/469 (27%)
RGD1565355NP_001102688.1 CD36 16..461 CDD:279474 125/471 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3776
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1106566at2759
OrthoFinder 1 1.000 FOG0000266
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.